KEGG   Mycobacterium tuberculosis H37Rv: Rv2245Help
Entry
Rv2245            CDS       T00015                                 

Gene name
kasA
Definition
(RefSeq) 3-oxoacyl-ACP synthase 1
  KO
K11609  beta-ketoacyl ACP synthase [EC:2.3.1.-]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mtu01004]
    Rv2245 (kasA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     Rv2245 (kasA)
Lipid biosynthesis proteins [BR:mtu01004]
 Fatty acid synthase
  Component type
   Rv2245 (kasA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N
Motif
Other DBs
NCBI-GeneID: 887269
NCBI-ProteinID: NP_216761
TubercuList: Rv2245
UniProt: P9WQD9 I6Y8T4
Structure
PDB: 

Position
2518115..2519365
Genome map
AA seq 416 aa AA seqDB search
MSQPSTANGGFPSVVVTAVTATTSISPDIESTWKGLLAGESGIHALEDEFVTKWDLAVKI
GGHLKDPVDSHMGRLDMRRMSYVQRMGKLLGGQLWESAGSPEVDPDRFAVVVGTGLGGAE
RIVESYDLMNAGGPRKVSPLAVQMIMPNGAAAVIGLQLGARAGVMTPVSACSSGSEAIAH
AWRQIVMGDADVAVCGGVEGPIEALPIAAFSMMRAMSTRNDEPERASRPFDKDRDGFVFG
EAGALMLIETEEHAKARGAKPLARLLGAGITSDAFHMVAPAADGVRAGRAMTRSLELAGL
SPADIDHVNAHGTATPIGDAAEANAIRVAGCDQAAVYAPKSALGHSIGAVGALESVLTVL
TLRDGVIPPTLNYETPDPEIDLDVVAGEPRYGDYRYAVNNSFGFGGHNVALAFGRY
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcagccttccaccgctaatggcggtttccccagcgttgtggtgaccgccgtcaca
gcgacgacgtcgatctcgccggacatcgagagcacgtggaagggtctgttggccggcgag
agcggcatccacgcactcgaagacgagttcgtcaccaagtgggatctagcggtcaagatc
ggcggtcacctcaaggatccggtcgacagccacatgggccgactcgacatgcgacgcatg
tcgtacgtccagcggatgggcaagttgctgggcggacagctatgggagtccgccggcagc
ccggaggtcgatccagaccggttcgccgttgttgtcggcaccggtctaggtggagccgag
aggattgtcgagagctacgacctgatgaatgcgggcggcccccggaaggtgtccccgctg
gccgttcagatgatcatgcccaacggtgccgcggcggtgatcggtctgcagcttggggcc
cgcgccggggtgatgaccccggtgtcggcctgttcgtcgggctcggaagcgatcgcccac
gcgtggcgtcagatcgtgatgggcgacgccgacgtcgccgtctgcggcggtgtcgaagga
cccatcgaggcgctgcccatcgcggcgttctccatgatgcgggccatgtcgacccgcaac
gacgagcctgagcgggcctcccggccgttcgacaaggaccgcgacggctttgtgttcggc
gaggccggtgcgctgatgctcatcgagacggaggagcacgccaaagcccgtggcgccaag
ccgttggcccgattgctgggtgccggtatcacctcggacgcctttcatatggtggcgccc
gcggccgatggtgttcgtgccggtagggcgatgactcgctcgctggagctggccgggttg
tcgccggcggacatcgaccacgtcaacgcgcacggcacggcgacgcctatcggcgacgcc
gcggaggccaacgccatccgcgtcgccggttgtgatcaggccgcggtgtacgcgccgaag
tctgcgctgggccactcgatcggcgcggtcggtgcgctcgagtcggtgctcacggtgctg
acgctgcgcgacggcgtcatcccgccgaccctgaactacgagacacccgatcccgagatc
gaccttgacgtcgtcgccggcgaaccgcgctatggcgattaccgctacgcagtcaacaac
tcgttcgggttcggcggccacaatgtggcgcttgccttcgggcgttactga

DBGET integrated database retrieval system