KEGG   Mycobacterium tuberculosis H37Rv: Rv2259Help
Entry
Rv2259            CDS       T00015                                 

Gene name
mscR
Definition
(RefSeq) S-nitrosomycothiol reductase MscR
  KO
K00153  S-(hydroxymethyl)mycothiol dehydrogenase [EC:1.1.1.306]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Rv2259 (mscR)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.306  S-(hydroxymethyl)mycothiol dehydrogenase
     Rv2259 (mscR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C ThiF AlaDh_PNT_C Sacchrp_dh_NADP F420_oxidored 2-Hacid_dh_C UDPG_MGDP_dh_N PrmA
Motif
Other DBs
NCBI-GeneID: 887215
NCBI-ProteinID: NP_216775
TubercuList: Rv2259
UniProt: O53533 A0A089QMX5
Position
2532245..2533330
Genome map
AA seq 361 aa AA seqDB search
MSQTVRGVIARQKGEPVELVNIVVPDPGPGEAVVDVTACGVCHTDLTYREGGINDEYPFL
LGHEAAGIIEAVGPGVTAVEPGDFVILNWRAVCGQCRACKRGRPRYCFDTFNAEQKMTLT
DGTELTAALGIGAFADKTLVHSGQCTKVDPAADPAVAGLLGCGVMAGLGAAINTGGVTRD
DTVAVIGCGGVGDAAIAGAALVGAKRIIAVDTDDTKLDWARTFGATHTVNAREVDVVQAI
GGLTDGFGADVVIDAVGRPETYQQAFYARDLAGTVVLVGVPTPDMRLDMPLVDFFSHGGA
LKSSWYGDCLPESDFPTLIDLYLQGRLPLQRFVSERIGLEDVEEAFHKMHGGKVLRSVVM
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagacggtgcgcggtgtgatcgcacgacaaaagggcgaacccgttgagctggtg
aacattgtcgtcccggatcccggacccggcgaggccgtggtcgacgtcaccgcctgcggg
gtatgccataccgacctgacctaccgcgagggcggcatcaacgacgaatacccttttctg
ctcggacacgaggccgcgggcatcatcgaggccgtcgggccgggtgtaaccgcagtcgag
cccggcgacttcgtgatcctgaactggcgtgccgtgtgcggccagtgccgggcctgcaaa
cgcggacggccccgctactgcttcgacacctttaacgccgaacagaagatgacgctgacc
gacggcaccgagctcactgcggcgttgggcatcggggcctttgccgataagacgctggtg
cactctggccagtgcacgaaggtcgatccggctgccgatcccgcggtggccggcctgctg
ggttgcggggtcatggccggcctgggcgccgcgatcaacaccggcggggtaacccgcgac
gacaccgtcgcggtgatcggctgcggcggcgttggcgatgccgcgatcgccggtgccgcg
ctggtcggcgccaaacggatcatcgcggtcgacaccgatgacacgaagcttgactgggcc
cgcaccttcggcgccacccacaccgtcaacgcccgcgaagtcgacgtcgtccaggccatc
ggcggcctcacggatggattcggcgcggacgtggtgatcgacgccgtcggccgaccggaa
acctaccagcaggccttctacgcccgcgatctcgccggaaccgttgtgctggtgggtgtt
ccgacgcccgacatgcgcctggacatgccgctggtcgacttcttctctcacggcggtgcg
ctgaagtcgtcgtggtacggcgattgcctgcccgaaagcgacttccccacgctgatcgac
ctttacctgcagggccggctgccgctgcagcggttcgtttccgaacgcatcgggctcgaa
gacgtcgaggaggcgttccacaagatgcatggcggcaaggtattgcgttcggtggtgatg
ttgtga

DBGET integrated database retrieval system