KEGG   Mycobacterium tuberculosis H37Rv: Rv2335Help
Entry
Rv2335            CDS       T00015                                 

Gene name
cysE
Definition
(RefSeq) serine acetyltransferase
  KO
K00640  serine O-acetyltransferase [EC:2.3.1.30]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00270  Cysteine and methionine metabolism
mtu00920  Sulfur metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01200  Carbon metabolism
mtu01230  Biosynthesis of amino acids
Module
mtu_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Rv2335 (cysE)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Rv2335 (cysE)
Enzymes [BR:mtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.30  serine O-acetyltransferase
     Rv2335 (cysE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2 SATase_N
Motif
Other DBs
NCBI-GeneID: 886012
NCBI-ProteinID: NP_216851
TubercuList: Rv2335
UniProt: P95231 I6Y0I3
Position
2609732..2610421
Genome map
AA seq 229 aa AA seqDB search
MLTAMRGDIRAARERDPAAPTALEVIFCYPGVHAVWGHRLAHWLWQRGARLLARAAAEFT
RILTGVDIHPGAVIGARVFIDHATGVVIGETAEVGDDVTIYHGVTLGGSGMVGGKRHPTV
GDRVIIGAGAKVLGPIKIGEDSRIGANAVVVKPVPPSAVVVGVPGQVIGQSQPSPGGPFD
WRLPDLVGASLDSLLTRVARLEALGGGPQAAGVIRPPEAGIWHGEDFSI
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgctgacggccatgcggggcgacatccgagcagcccgggagcgggatccggcggcccct
accgcgctggaagtcatcttctgctacccgggcgtgcacgccgtgtggggccaccgcctc
gcccactggctgtggcagcgtggcgccaggctgctcgcgcgggcagctgccgaattcact
cgcatcctgaccggtgtagatatccaccccggtgccgtcatcggtgctcgcgtgttcatc
gaccacgcgaccggcgtggtgatcggagaaaccgcggaggtcggcgacgacgtcacgatc
tatcacggcgtcactctcggcggcagtggcatggttggcgggaaacgccatcccaccgtc
ggtgaccgcgtgatcatcggcgccggggccaaggtcctcggtccgatcaagatcggcgag
gacagccggatcggcgccaatgccgtcgtggtcaagcccgtcccgccgagcgcggtggtg
gtcggggtgcccgggcaggtcatcggccaaagccagcccagtcccggcggcccgtttgat
tggaggctgcccgatctcgtgggagccagcctcgattcgctgctcaccagggtggccagg
ctggaggccctcggcggcggcccgcaagcagcaggagtcatccggccacccgaagccggg
atatggcacggcgaggacttctcgatctga

DBGET integrated database retrieval system