KEGG   Mycobacterium tuberculosis H37Rv: Rv2361cHelp
Entry
Rv2361c           CDS       T00015                                 

Gene name
uppS
Definition
(RefSeq) decaprenyl diphosphate synthase
  KO
K14215  trans,polycis-decaprenyl diphosphate synthase [EC:2.5.1.86]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00900  Terpenoid backbone biosynthesis
mtu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rv2361c (uppS)
Enzymes [BR:mtu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.86  trans,polycis-decaprenyl diphosphate synthase
     Rv2361c (uppS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Prenyltransf
Motif
Other DBs
NCBI-GeneID: 888964
NCBI-ProteinID: NP_216877
TubercuList: Rv2361c
UniProt: P9WFF7 I6XE49
Structure
PDB: 

Position
complement(2642578..2643468)
Genome map
AA seq 296 aa AA seqDB search
MARDARKRTSSNFPQLPPAPDDYPTFPDTSTWPVVFPELPAAPYGGPCRPPQHTSKAAAP
RIPADRLPNHVAIVMDGNGRWATQRGLARTEGHKMGEAVVIDIACGAIELGIKWLSLYAF
STENWKRSPEEVRFLMGFNRDVVRRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEM
TKSNDVITINYCVNYGGRTEITEATREIAREVAAGRLNPERITESTIARHLQRPDIPDVD
LFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGSA
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtggctagggatgcacggaagcggacgtccagcaacttcccgcagctgcctccggccccc
gacgactacccgacctttcctgatacgtcgacgtggcccgtcgtcttcccggagttgccg
gcagcgccctacggaggcccctgccggccaccgcagcacacttcgaaagcggccgcgcca
cgaataccggccgaccggctgcccaaccatgtcgccattgtcatggacggcaatggccgc
tgggccacccaacgtgggctggcccgcaccgaaggtcacaagatgggcgaggcggtggtg
atcgacatcgcttgcggtgctatcgaacttgggatcaagtggctcagcctctacgccttc
tccacggagaactggaagcgttcgcccgaggaagtccgcttcctgatgggcttcaaccgc
gacgtggtgcgacggcgccgagacaccctaaagaagctaggggtccggatccggtgggtg
ggttcacgaccacggctgtggcgtagcgtcatcaatgagttggcggtcgcggaggagatg
accaaaagcaacgacgtcatcaccatcaactattgcgtcaactacggcggacgcaccgaa
atcaccgaagccacccgcgaaatcgctcgtgaggtcgccgcgggcaggctcaacccggag
cggatcaccgaatccacgatcgcccgccacctgcagcgacccgacattcccgacgttgac
ctcttcctgcggacctcgggtgagcagcgctccagcaacttcatgctgtggcaggcggcc
tacgctgaatacatattccaggacaagctctggcccgactatgaccgccgcgacttgtgg
gcggcctgcgaggaatacgcgtcgcgcactcggcggttcgggagcgcctag

DBGET integrated database retrieval system