KEGG   Mycobacterium tuberculosis H37Rv: Rv2382cHelp
Entry
Rv2382c           CDS       T00015                                 

Gene name
mbtC
Definition
(RefSeq) polyketide synthetase
  KO
K04790  mycobactin polyketide synthetase MbtC
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu01053  Biosynthesis of siderophore group nonribosomal peptides
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    Rv2382c (mbtC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mtu01004]
    Rv2382c (mbtC)
   01008 Polyketide biosynthesis proteins [BR:mtu01008]
    Rv2382c (mbtC)
Lipid biosynthesis proteins [BR:mtu01004]
 Polyketide synthase
  Component type
   Rv2382c (mbtC)
Polyketide biosynthesis proteins [BR:mtu01008]
 Nonribosomal peptide synthetase (NRPS)
  Nonlinear NRPS
   Mycobactin synthetase
    Rv2382c (mbtC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc
Motif
Other DBs
NCBI-GeneID: 885908
NCBI-ProteinID: NP_216898
TubercuList: Rv2382c
UniProt: A0A089QN91 P71718
Position
complement(2670269..2671603)
Genome map
AA seq 444 aa AA seqDB search
MSDNDPVVIVGLAIEAPGGVETADDYWTLLSEQREGLGPFPTDRGWALRELFDGSRRNGF
KPIHNLGGFLSSATTFDPEFFRISPREATAMDPQQRVGLRVAWRTLENSGINPDDLAGHD
VGCYVGASALEYGPALTEFSHHSGHLITGTSLGVISGRIAYTLDLAGPALTVDTSCSSAL
AAFHTAVQAIRAGDCDLALAGGVCVMGTPGYFVEFSKQHALSDDGHCRPYSAHASGTAWA
EGAAMFLLQRRSRATADRRRVLAEVRASCLNSDGLSDGLTAPSGDAQTRLLRRAIAQAAV
VPADVGMVEGHGTATRLGDRTELRSLAASYGTAPAGRGPLLGSVKSNIGHAQAAAGGLGL
VKVILAAQHAAIPPTLHVDEPSREIDWEKQGLRLADKLTPWRAVDGWRTAAVSAFGMSGT
NSHVIVSMPDTVSAPERGPECGEV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgtccgataacgacccggtcgtcatcgtcgggctggccatcgaggcacccggtggtgtc
gaaaccgccgacgactactggacactgctctccgaacagcgcgagggactcggaccgttc
cccaccgatcgaggttgggcacttcgcgagctgttcgacgggtcgcgtcgaaacggattc
aaaccgatccacaaccttggcggattcctttccagcgcaactacattcgatcctgagttc
ttccgcatctcaccgcgcgaggcgacggcgatggacccgcagcagcgggtggggctgcga
gtagcatggcgcaccctggagaacagcgggatcaatcccgatgacctggccggtcacgat
gtgggctgttatgtcggtgcctcggcgctcgaatacggtcccgctttgaccgaattctcc
caccacagtggccatctgatcaccgggacgtcgctgggtgtcatctccgggcgcatcgcc
tacacccttgacctggccgggccggcgctgaccgtcgatacctcgtgttcgtcggcgctg
gcggcctttcacaccgcggttcaagctatccgggccggcgactgcgacctggcactcgcc
ggcggcgtgtgcgtgatgggtacgcccggctatttcgtcgagttctccaagcagcacgcg
ctatccgacgacggccactgccggccctacagcgcgcacgccagcggaaccgcctgggca
gagggcgccgccatgttcctcctgcagcgccggtcgcgggcaaccgctgaccggcgtcgt
gtcctcgccgaggtgcgtgccagttgcctgaactccgatggacttagcgacgggctgacc
gcgcccagcggcgacgcgcaaacgcgactgctccggcgcgccatcgcgcaggcagcagtt
gtgcccgccgatgtcgggatggtcgaagggcacggcaccgcgacccggctcggcgatcgc
accgaattgcggtcactggcagccagctacggcaccgccccggccggacgcgggccgctg
ttgggatcggtcaagtcaaacatcgggcatgctcaggcggcggcgggcgggctgggcctt
gtgaaggtcattctggccgcccagcacgccgcgatcccgccgacactgcacgtcgacgag
cccagccgcgaaatcgattgggagaaacagggtctgcggctggccgacaaactcacgccg
tggcgggccgttgacggatggcgcaccgcggcggtgtccgcgttcgggatgagcggtacc
aatagccacgtgatcgtttcgatgccggacaccgtttccgcgcccgagcgtggccccgag
tgtggggaggtgtga

DBGET integrated database retrieval system