KEGG   Mycobacterium tuberculosis H37Rv: Rv2384Help
Entry
Rv2384            CDS       T00015                                 

Gene name
mbtA
Definition
(RefSeq) 2,3-dihydroxybenzoate-AMP ligase
  KO
K04787  mycobactin salicyl-AMP ligase [EC:6.3.2.-]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu01053  Biosynthesis of siderophore group nonribosomal peptides
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    Rv2384 (mbtA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:mtu01008]
    Rv2384 (mbtA)
Enzymes [BR:mtu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.-  
     Rv2384 (mbtA)
Polyketide biosynthesis proteins [BR:mtu01008]
 Nonribosomal peptide synthetase (NRPS)
  Nonlinear NRPS
   Mycobactin synthetase
    Rv2384 (mbtA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 885833
NCBI-ProteinID: NP_216900
TubercuList: Rv2384
UniProt: A0A089QUP0 P71716
Position
2675936..2677633
Genome map
AA seq 565 aa AA seqDB search
MPPKAADGRRPSPDGGLGGFVPFPADRAASYRAAGYWSGRTLDTVLSDAARRWPDRLAVA
DAGDRPGHGGLSYAELDQRADRAAAALHGLGITPGDRVLLQLPNGCQFAVALFALLRAGA
IPVMCLPGHRAAELGHFAAVSAATGLVVADVASGFDYRPMARELVADHPTLRHVIVDGDP
GPFVSWAQLCAQAGTGSPAPPADPGSPALLLVSGGTTGMPKLIPRTHDDYVFNATASAAL
CRLSADDVYLVVLAAGHNFPLACPGLLGAMTVGATAVFAPDPSPEAAFAAIERHGVTVTA
LVPALAKLWAQSCEWEPVTPKSLRLLQVGGSKLEPEDARRVRTALTPGLQQVFGMAEGLL
NFTRIGDPPEVVEHTQGRPLCPADELRIVNADGEPVGPGEEGELLVRGPYTLNGYFAAER
DNERCFDPDGFYRSGDLVRRRDDGNLVVTGRVKDVICRAGETIAASDLEEQLLSHPAIFS
AAAVGLPDQYLGEKICAAVVFAGAPITLAELNGYLDRRGVAAHTRPDQLVAMPALPTTPI
GKIDKRAIVRQLGIATGPVTTQRCH
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgccaccgaaggcggcagatggccgccgacccagtcccgacggcggactgggtggcttt
gtaccgttccccgcggatcgggccgcgtcgtaccgggcggccggctattggtcggggcga
accctggacaccgtgctctccgatgccgcgcggcgctggcctgaccgcctcgcggtggcc
gacgccggtgatcgtcccggccacggcggcctcagttacgccgaactcgaccagcgggcc
gaccgggccgccgcggcgctgcacggcctgggcatcacgccaggcgaccgggtactgctc
cagctgccaaacggctgccagttcgcggttgccctgttcgcgttattgcgggcgggagcg
atcccagtgatgtgcctgcccggtcaccgcgccgccgaattgggccacttcgccgccgtc
agcgcggccaccgggctggtggtcgccgatgtggccagcgggttcgactatcggccgatg
gcgcgcgaacttgttgccgatcaccccaccctgcgccatgtcatcgtcgatggcgatccg
ggaccgttcgtgtcgtgggcgcagctgtgcgcccaggccggcaccggttcgccggcaccg
ccggccgatcccggatcgccagcgctgctgctggtctccggcggcaccactggcatgccc
aaactcattccacgcacccacgacgactacgtgttcaacgcgacggccagcgccgcactc
tgtcggcttagcgccgacgacgtctatctggtggtgctggccgccggccacaatttcccg
ctggcctgcccgggcctgctcggcgcgatgaccgtcggggccaccgccgtgttcgccccc
gatcccagcccggaggccgccttcgccgccatcgagcgccacggtgtcaccgtcaccgcg
ttggttccggcactggccaaactgtgggcccaatcctgtgagtgggagccggtgacaccg
aagtcactgcggttgttgcaggttggcgggtccaagctagaacccgaggacgctcgccgg
gtacgcaccgcgctcaccccgggcctgcagcaggtgttcggcatggcggaggggctgctg
aacttcacccgcatcggcgacccacccgaagtggtggagcacacccaggggcggccacta
tgcccggccgacgaactgcgcatcgtcaacgccgatggtgagccggtggggcccggggag
gaaggcgaactcttggtgcgcgggccctacacgctgaacggctattttgctgccgaacgc
gacaacgagcgctgcttcgatccggacggcttctaccgcagcggcgacctggtccgccgc
cgcgacgacggcaatctggtggtcaccgggcgcgtcaaggatgtcatctgccgtgcggga
gaaaccatcgccgccagcgacctcgaagaacagctgctgagccatccggcgatcttctcg
gccgcggcggtgggactacctgaccagtatctgggggaaaaaatctgcgctgcagtcgtt
ttcgctggagctccgattacgcttgcggagttgaacggctaccttgaccggcgtggtgtg
gccgcgcatacgcgacccgaccagctggtcgcgatgccggcgctgcccacaacgccgatc
gggaagatcgacaaacgagcgatcgtccgccagctcggcatcgcgacgggtcccgtgacg
acccagcgctgccattga

DBGET integrated database retrieval system