KEGG   Mycobacterium tuberculosis H37Rv: Rv2391Help
Entry
Rv2391            CDS       T00015                                 

Gene name
sirA
Definition
(RefSeq) sulfite reductase
  KO
K00392  sulfite reductase (ferredoxin) [EC:1.8.7.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00920  Sulfur metabolism
mtu01100  Metabolic pathways
mtu01120  Microbial metabolism in diverse environments
Module
mtu_M00176  Assimilatory sulfate reduction, sulfate => H2S
mtu_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Rv2391 (sirA)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.7  With an iron-sulfur protein as acceptor
    1.8.7.1  assimilatory sulfite reductase (ferredoxin)
     Rv2391 (sirA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NIR_SIR NIR_SIR_ferr
Motif
Other DBs
NCBI-GeneID: 885472
NCBI-ProteinID: NP_216907
TubercuList: Rv2391
UniProt: P9WJ03 I6YDA2
Structure
PDB: 

Position
2684679..2686370
Genome map
AA seq 563 aa AA seqDB search
MSAKENPQMTTARPAKARNEGQWALGHREPLNANEELKKAGNPLDVRERIENIYAKQGFD
SIDKTDLRGRFRWWGLYTQREQGYDGTWTGDDNIDKLEAKYFMMRVRCDGGALSAAALRT
LGQISTEFARDTADISDRQNVQYHWIEVENVPEIWRRLDDVGLQTTEACGDCPRVVLGSP
LAGESLDEVLDPTWAIEEIVRRYIGKPDFADLPRKYKTAISGLQDVAHEINDVAFIGVNH
PEHGPGLDLWVGGGLSTNPMLAQRVGAWVPLGEVPEVWAAVTSVFRDYGYRRLRAKARLK
FLIKDWGIAKFREVLETEYLKRPLIDGPAPEPVKHPIDHVGVQRLKNGLNAVGVAPIAGR
VSGTILTAVADLMARAGSDRIRFTPYQKLVILDIPDALLDDLIAGLDALGLQSRPSHWRR
NLMACSGIEFCKLSFAETRVRAQHLVPELERRLEDINSQLDVPITVNINGCPNSCARIQI
ADIGFKGQMIDDGHGGSVEGFQVHLGGHLGLDAGFGRKLRQHKVTSDELGDYIDRVVRNF
VKHRSEGERFAQWVIRAEEDDLR
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcgaaggagaacccccaaatgaccactgcacgtcccgccaaggctcgaaatgag
ggccagtgggcgctgggacatcgcgagccactcaacgccaacgaagagctgaagaaggcc
ggcaacccgctcgacgtgcgggagcgcatcgaaaacatctacgccaaacagggtttcgac
agcatcgacaagaccgacctgcgagggcgctttcgctggtggggcctgtacacccagcgt
gagcagggctacgacggcacctggaccggtgacgacaacatcgacaagctcgaggccaaa
tacttcatgatgcgggtgcgttgcgacggcggcgcgctctcggctgccgcgctgcgcacg
ctgggccagatctcgacggagttcgcgcgcgataccgccgatatctccgaccggcagaac
gtgcaataccactggatcgaagtggaaaacgtccctgaaatctggcgacggttagacgat
gtcggactgcagaccaccgaggcgtgcggtgactgcccgcgggtagtgctgggctcgccg
ttggccggcgagtcgctcgacgaagtgctcgacccgacctgggcgatcgaggagatcgtg
cgtcgctacatcggcaagcccgacttcgccgacttgccgcgcaagtacaagaccgccatc
tctggcctgcaggacgtcgcgcacgagatcaacgacgtcgccttcatcggcgtcaaccat
cccgagcacggaccaggcctggatctgtgggtgggcggtggactgtcgaccaacccgatg
ctggcccagcgggtcggcgcctgggttccactgggcgaagtgcccgaggtgtgggcggcg
gtcacctcggtgtttcgcgactacggctaccggcgactgcgcgccaaggcccggctgaaa
tttctgatcaaagactggggcatagcgaagttccgcgaagtgctcgaaaccgagtacctc
aagcgtccgctgatcgacggtccggcccccgaaccggtcaagcatccgatcgaccacgtc
ggggtgcaacgactcaagaacgggctcaacgccgtcggagtcgcccccatcgccgggcgg
gtatcgggcaccatcctcacggcggtcgccgacctgatggcgcgggccggttccgaccgg
atccggttcaccccctaccagaagctggtcatcctcgacattccggacgccttgctcgac
gacttgatcgccggtctggacgcgctggggctgcagtcgcgcccgtcgcattggcgccgg
aacttgatggcgtgcagcgggattgagttctgcaagttgtcattcgccgaaacccgggtt
cgagcacagcatttggtgcccgagctggaacgccggcttgaggacatcaactcgcagctc
gacgtaccgatcaccgtcaacatcaacggctgcccgaactcatgtgcgcgaattcaaatc
gccgacatcggattcaagggacagatgatcgacgacggacacggcggctccgtcgaaggc
ttccaggtgcatctgggcggacacctcggcctggatgccggattcggccgcaaactgcgc
cagcacaaggtcaccagtgacgaactcggcgactacatcgaccgggtggtgcgcaacttc
gtcaaacaccgcagcgaaggtgaacgcttcgcgcagtgggtcatccgggccgaggaggac
gacctgcgatga

DBGET integrated database retrieval system