KEGG   Mycobacterium tuberculosis H37Rv: Rv2421cHelp
Entry
Rv2421c           CDS       T00015                                 

Gene name
nadD
Definition
(RefSeq) nicotinate-nucleotide adenylyltransferase
  KO
K00969  nicotinate-nucleotide adenylyltransferase [EC:2.7.7.18]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00760  Nicotinate and nicotinamide metabolism
mtu01100  Metabolic pathways
Module
mtu_M00115  NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Rv2421c (nadD)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     Rv2421c (nadD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like HIGH_NTase1 DUF4863
Motif
Other DBs
NCBI-GeneID: 885457
NCBI-ProteinID: NP_216937
TubercuList: Rv2421c
UniProt: P9WJJ5 I6X474
Structure
PDB: 

Position
complement(2718173..2718808)
Genome map
AA seq 211 aa AA seqDB search
MGGTFDPIHYGHLVAASEVADLFDLDEVVFVPSGQPWQKGRQVSAAEHRYLMTVIATASN
PRFSVSRVDIDRGGPTYTKDTLADLHALHPDSELYFTTGADALASIMSWQGWEELFELAR
FVGVSRPGYELRNEHITSLLGQLAKDALTLVEIPALAISSTDCRQRAEQSRPLWYLMPDG
VVQYVSKCRLYCGACDAGARSTTSLAAGNGL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgggtgggacgttcgaccccatccactacggccacctggttgccgccagcgaggtggcc
gacctgttcgatctcgacgaagtggtattcgtgcccagcgggcaaccctggcaaaagggt
cgacaggtctccgccgccgagcaccgctacctaatgacggtgatcgccaccgcctccaat
ccccgattctctgtgagccgggtcgacatcgaccgcggcggacccacctacaccaaggac
acgctggccgatctgcatgctttgcacccggactctgagctgtacttcaccaccggcgcc
gatgcgctagcttccataatgtcctggcagggctgggaggagctgttcgaattggcgcgg
ttcgtgggggtcagccggcccggctacgagttgcgcaacgaacacatcactagcctgctg
ggtcagctggccaaggatgcgttgactctggtcgagatcccggcgctggccatttcgtcg
accgactgccgtcagcgcgccgagcagtcccggccgctgtggtacctgatgcccgacggc
gtcgtgcagtatgtctccaagtgccggctctactgtggcgcctgcgacgcgggcgcgcgt
tcaacgaccagcctggccgctgggaatggcctatga

DBGET integrated database retrieval system