KEGG   Mycobacterium tuberculosis H37Rv: Rv2427cHelp
Entry
Rv2427c           CDS       T00015                                 

Gene name
proA
Definition
(RefSeq) gamma-glutamyl phosphate reductase
  KO
K00147  glutamate-5-semialdehyde dehydrogenase [EC:1.2.1.41]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00330  Arginine and proline metabolism
mtu00332  Carbapenem biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
mtu01230  Biosynthesis of amino acids
Module
mtu_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Rv2427c (proA)
  09110 Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Rv2427c (proA)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     Rv2427c (proA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh CHAD
Motif
Other DBs
NCBI-GeneID: 885536
NCBI-ProteinID: NP_216943
TubercuList: Rv2427c
UniProt: P9WHV1 I6Y999
Position
complement(2724230..2725477)
Genome map
AA seq 415 aa AA seqDB search
MTVPAPSQLDLRQEVHDAARRARVAARRLASLPTTVKDRALHAAADELLAHRDQILAANA
EDLNAAREADTPAAMLDRLSLNPQRVDGIAAGLRQVAGLRDPVGEVLRGYTLPNGLQLRQ
QRVPLGVVGMIYEGRPNVTVDAFGLTLKSGNAALLRGSSSAAKSNEALVAVLRTALVGLE
LPADAVQLLSAADRATVTHLIQARGLVDVVIPRGGAGLIEAVVRDAQVPTIETGVGNCHV
YVHQAADLDVAERILLNSKTRRPSVCNAAETLLVDAAIAETALPRLLAALQHAGVTVHLD
PDEADLRREYLSLDIAVAVVDGVDAAIAHINEYGTGHTEAIVTTNLDAAQRFTEQIDAAA
VMVNASTAFTDGEQFGFGAEIGISTQKLHARGPMGLPELTSTKWIAWGAGHTRPA
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgccagcaccgtcgcagctcgacttgcgtcaagaggtgcacgacgccgcacgc
cgcgcccgggtggccgcccgccggctggcatcgctgccgacgactgtcaaagaccgcgcg
ctgcacgcggctgccgacgagctactggctcaccgcgaccagatcctggcggccaacgcc
gaagacctgaacgcggcgcgcgaggcggacaccccggccgccatgctggaccggttgtcc
ttgaacccgcaacgagtcgacggtatcgccgccgggttgcggcaagtcgcgggactgcgc
gatccggtcggtgaagtgctgcgtggctataccctgcccaacgggctgcagctgcgccag
cagcgcgtccccctgggcgtggtcggcatgatctacgagggccgccccaatgtcaccgtg
gatgccttcgggctgacactcaagtcgggtaacgctgcattgctgcgcggcagctcgtcg
gccgcaaagtccaacgaggccctggtggcggtgttacgcaccgcgctggtcggcctggag
ctgccggccgacgcggtccagctgctgtcggctgccgaccgcgccaccgtcactcacctg
attcaggcccgcggcctggtcgatgtggtgattccacgcgggggagcgggcctgatcgag
gcggtcgtacgcgatgcccaggtgcccaccatcgagaccggcgtcgggaactgccatgtc
tacgtgcaccaagcggccgacctggacgtggccgagcgtatcttgctgaactccaagacg
cggcggcccagcgtctgcaacgccgccgagacgctgctggtcgacgcagcgatcgccgaa
acggcgttgcctcgattgctggccgccctgcagcacgccggtgtcaccgtacatctcgac
ccggacgaggccgacctgcgccgcgaatacctgtcgctggacatcgcggtggcggtggtc
gacggtgtcgacgctgccatcgcccatatcaacgaatacggcaccgggcacacagaagcg
attgtgaccaccaatcttgatgcggcccaacgctttaccgaacagatcgatgcggccgcg
gtgatggtgaacgcatcaacggcgttcaccgacggcgagcaattcggcttcggcgccgag
atcggcatctccacccagaaactgcatgcccgcggaccgatgggactaccggaattgacg
tcgaccaagtggatcgcatggggagccggccacacccgtccggcctga

DBGET integrated database retrieval system