KEGG   Mycobacterium tuberculosis H37Rv: Rv2435cHelp
Entry
Rv2435c           CDS       T00015                                 

Definition
(RefSeq) cyclase
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_cyc HAMP HNOBA IncA
Motif
Other DBs
NCBI-GeneID: 885891
NCBI-ProteinID: NP_216951
TubercuList: Rv2435c
UniProt: A0A089QPF3 P71914
Position
complement(2730557..2732749)
Genome map
AA seq 730 aa AA seqDB search
MTSGEALDSVAESESTPAKKRHKNVLRRRPRFRASIQSKLMVLLLLTSIVSVAAIAAIVY
QSGRTSLRAAAYERLTQLRESQKRAVETLFSDLTNSLVIYERGLTVVDAVVRFTAGFDQL
ADATISPAQQQAIVNYYNNEFITPVERTTGDKLDITALLPTSPAQRYLQAYYTAPFTSDQ
DAMRLDDAGDGSAWSAANAQFNSYFREIVTRFDYDDAVLLDTRGNIVYTLSKDPDLGTNI
LTGPYRESNLRDAYLKALGANAVDFTWITDFKPYQPQLGVPTAWLVAPVEAGGKTQGVLA
LPLPIDKINKIMTADRQWQAAGMGSGTETYLAGPDSLMRSDSRLFLQDPEEYRKQVVAAG
TSLDVVNRAIQFGGTTLLQPVATEGLRAAQRGQTGTVTSTDYTGSRELEAYAPLNVPDSD
LHWSILATRNDSEAFAAVASFSRALVLVTVGIIVVICVASMLIAHAMVRPIRRLEVGTQK
ISAGDYEVNIPVKSRDEIGDLTAAFNEMSRNLQTKEELLNEQRKENDRLLLSMMPEPVVE
RYRLGEQTIAQEHQDVTVLFADILGVDEISSGLSGNELVKIVDELVRQFDSAAEHLGVER
IRTLHNGYLAGCGVTTPRLDNIPRTVDFALEMRRIVDRFNCQTGNDLHLRVGINTGDVIS
GLVGRSSVVYDMWGAAVSLAYQMHSGSPQPGIYVTSQVYEAMRDVWQFTAAGTISVGGLE
EPIYRLSERS
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
ttgacgtcgggtgaggcactggactcggtagccgagagtgaatccaccccggctaagaag
cgccataagaatgtgctccggcgtcggccgcgtttccgggccagcatccagtccaagctc
atggtgctgctgctgttgacgagtatcgtgtccgtcgcggcgattgcggccattgtctat
caatctggtcgcacttcgctaagagcagccgcctacgagcggttgacccagttgcgcgag
tcgcagaagcgggcagttgagacactattttctgacctgacgaattcgctggtcatttac
gaacgtggactcacggttgtcgatgccgtcgtgcggttcacggccggctttgaccagctg
gctgacgccacgatcagccccgcccaacaacaggcgatcgtcaactactacaacaacgaa
ttcatcacacccgtcgaacgcacgaccggcgataaactcgacatcaccgcgctgctgccg
acttctccggcccaaaggtatcttcaggcgtactacactgcaccattcacgtcggaccaa
gatgcgatgcggctggacgatgccggcgacggcagtgcatggtcggccgccaacgcgcaa
ttcaacagctatttccgggaaatcgtcacccggttcgattacgacgacgcggtattgctg
gacacccggggcaatatcgtctataccctgagcaaggaccccgacctcggtaccaacatt
ctgaccgggccgtatcgcgaatccaatctgcgtgacgcctaccttaaagcgttgggcgcc
aacgccgtcgactttacctggattaccgacttcaagccgtatcagcctcaactcggcgtg
ccgaccgcgtggttggtggcaccggtcgaagcgggcggcaaaactcagggcgttttggcg
ctgccgttgccgatcgacaagatcaataagatcatgaccgccgacaggcaatggcaagcg
gctggcatgggtagtgggacggaaacctatctcgccggtccggacagtctgatgcggtcc
gattctcggctcttcctgcaagacccggaggaataccggaaacaggttgtggcagcaggc
acgtcacttgatgtggtcaacagagcgatccagttcggtgggacgacgctgctgcagcct
gttgcgaccgaaggactgcgcgccgcccaacgcggacagaccggaaccgtcacctccacc
gactacacgggtagcagggaactggaggcctacgcgccgctgaatgtgccggactccgat
ctgcactggtcgatcctggcaacgcggaacgattctgaggcgttcgcggccgtcgcgtcg
ttcagcagggcgcttgtgctggttacagttggcatcattgtcgtcatctgtgtggcgtcg
atgctgatcgcccatgcgatggtgcggccaatccggcggctcgaggttggcacccagaag
atcagcgcaggcgactacgaagtcaacattccggtaaagtcacgcgacgaaatcggtgat
cttacagccgctttcaacgagatgagtcggaatctgcaaaccaaagaggagctgctcaac
gagcaacgcaaggaaaacgaccggttattgctatcgatgatgcccgagccagttgtcgag
cggtaccgccttggggagcagaccattgcgcaggagcaccaagatgtcaccgtcctgttt
gccgacatcctgggtgtcgacgagatttccagcggcctgtcgggtaacgaactggtcaaa
attgtcgacgagctggtccgccagttcgattcggccgccgaacaccttggtgtcgaacgc
attcgcacgctgcacaatggctatctcgccggttgcggggtaaccacgccacggctggac
aatattccccgaaccgtcgacttcgccctagagatgcggcgcatcgtcgatcggttcaat
tgccaaaccggtaacgatctgcacctgcgagtcggtatcaacaccggggacgtcattagc
gggctggtcggcagatcaagtgtcgtctacgacatgtggggcgcggcagtgagtctggcc
taccaaatgcacagcggttcaccacagcccggcatctatgtcacctcgcaggtgtatgag
gcgatgcgagacgtgtggcagttcacggctgcgggcacgatttctgtcggagggttagaa
gagccgatctaccgattgtcggagcgatcatga

DBGET integrated database retrieval system