KEGG   Mycobacterium tuberculosis H37Rv: Rv2438cHelp
Entry
Rv2438c           CDS       T00015                                 

Gene name
nadE
Definition
(RefSeq) glutamine-dependent NAD(+) synthetase
  KO
K01950  NAD+ synthase (glutamine-hydrolysing) [EC:6.3.5.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00760  Nicotinate and nicotinamide metabolism
mtu01100  Metabolic pathways
Module
mtu_M00115  NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Rv2438c (nadE)
Enzymes [BR:mtu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.1  NAD+ synthase (glutamine-hydrolysing)
     Rv2438c (nadE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_synthase CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 885808
NCBI-ProteinID: NP_216954
TubercuList: Rv2438c
UniProt: P9WJJ3 I6Y0Q6
Structure
PDB: 

Position
complement(2734792..2736831)
Genome map
AA seq 679 aa AA seqDB search
MNFYSAYQHGFVRVAACTHHTTIGDPAANAASVLDMARACHDDGAALAVFPELTLSGYSI
EDVLLQDSLLDAVEDALLDLVTESADLLPVLVVGAPLRHRHRIYNTAVVIHRGAVLGVVP
KSYLPTYREFYERRQMAPGDGERGTIRIGGADVAFGTDLLFAASDLPGFVLHVEICEDMF
VPMPPSAEAALAGATVLANLSGSPITIGRAEDRRLLARSASARCLAAYVYAAAGEGESTT
DLAWDGQTMIWENGALLAESERFPKGVRRSVADVDTELLRSERLRMGTFDDNRRHHRELT
ESFRRIDFALDPPAGDIGLLREVERFPFVPADPQRLQQDCYEAYNIQVSGLEQRLRALDY
PKVVIGVSGGLDSTHALIVATHAMDREGRPRSDILAFALPGFATGEHTKNNAIKLARALG
VTFSEIDIGDTARLMLHTIGHPYSVGEKVYDVTFENVQAGLRTDYLFRIANQRGGIVLGT
GDLSELALGWSTYGVGDQMSHYNVNAGVPKTLIQHLIRWVISAGEFGEKVGEVLQSVLDT
EITPELIPTGEEELQSSEAKVGPFALQDFSLFQVLRYGFRPSKIAFLAWHAWNDAERGNW
PPGFPKSERPSYSLAEIRHWLQIFVQRFYSFSQFKRSALPNGPKVSHGGALSPRGDWRAP
SDMSARIWLDQIDREVPKG
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgaacttttactccgcctaccagcacgggttcgtgcgcgttgccgcctgcactcaccac
accaccatcggtgacccggcggccaacgccgcgtcggtattggacatggcccgtgcgtgc
cacgacgatggcgcagcgttggcggtctttcctgagctgacgctgtcgggctactccatc
gaggacgtactactgcaggactctctgctcgatgccgtcgaggacgcgctgctcgacctg
gtgaccgaatccgccgacctgttacctgtactggtggtcggggctccgctgcggcatcga
caccgcatctacaacaccgcggtcgtcattcaccgcggcgccgtgctcggcgtggtgccc
aagtcgtatctacccacctatcgcgagttctacgagcggcgccagatggcgcccggagac
ggggagcggggcacgatccgcatcggtggcgccgacgtggccttcggcacggacctgttg
ttcgccgcgtcagatctacccggctttgtgttgcatgtggagatctgcgaggacatgttt
gtgccgatgccgcccagcgccgaggcggccctggcgggcgcgacggtgctggcgaatctg
tccggcagcccgatcaccatcggccgtgccgaggaccgccggctgcttgcgcgctcggcg
tcggcgcggtgtctggctgcctatgtctatgccgccgcgggggagggggagtcaacgacg
gacctggcctgggacggtcagacgatgatctgggagaatggcgcactgctcgcggagtcc
gaacgtttccccaaaggagtgcgccgcagtgtcgccgacgttgacaccgagttgcttcgg
tcggagcggctgcggatgggcacgttcgacgacaaccggcgtcaccaccgggagttaacg
gaatcgttccggcgcatcgacttcgcactcgacccaccggcaggcgacatcggactgctg
cgcgaggtcgagcggttcccgttcgttccggccgatccgcaacgattgcaacaggattgc
tacgaggcctacaacatccaggtgtctggactcgagcaacggttgcgggcgctggactat
ccgaaggtcgttatcggtgtgtccgggggattggactcgacgcacgcgctgatcgtcgcg
acccatgccatggaccgcgagggccggccgcgcagcgacattctggcgtttgcgttgccc
ggattcgccaccggggagcacactaagaacaacgcgatcaagctggcacgtgcgctgggg
gttaccttctccgaaatcgatatcggcgacaccgctcggttgatgctgcacacaatcggc
catccgtattcggttggcgaaaaagtgtacgacgtcaccttcgagaacgtccaggccggg
ttgcgcaccgactatcttttccgtatcgccaaccagcgcgggggaatcgtactgggcacc
ggggacctgtcggagctggcactgggttggtcgacatacggtgtcggcgaccagatgtcg
cactacaacgtcaacgccggtgtgcccaagacgctgatccagcacctgatccggtgggtc
atttcggcgggtgagttcggtgagaaggtgggtgaggtattgcagtcggtgctcgacacc
gagatcacccccgaactcattccgaccggcgaggaggagctgcagagcagcgaggccaag
gtcggacctttcgccctacaggacttttcgctttttcaggtactgcgctacggatttcgc
ccgtcgaagattgcgtttttggcctggcatgcgtggaacgatgcggagcggggcaactgg
ccgcccggcttcccaaagagcgaacgcccgtcctattcattggccgaaatccggcattgg
ctgcagattttcgtccagcggttttattcgtttagccagttcaagcgttcggcattgccc
aacggccccaaggtgtcccacgggggcgcgttgtcgccgcgtggggattggcgggccccg
tcggatatgtcagcgcgaatctggctcgatcagatcgaccgtgaggtgcccaagggctag

DBGET integrated database retrieval system