KEGG   Mycobacterium tuberculosis H37Rv: Rv2447cHelp
Entry
Rv2447c           CDS       T00015                                 

Gene name
folC
Definition
(RefSeq) folylpolyglutamate synthase FolC
  KO
K11754  dihydrofolate synthase / folylpolyglutamate synthase [EC:6.3.2.12 6.3.2.17]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00790  Folate biosynthesis
mtu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rv2447c (folC)
Enzymes [BR:mtu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.12  dihydrofolate synthase
     Rv2447c (folC)
    6.3.2.17  tetrahydrofolate synthase
     Rv2447c (folC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C
Motif
Other DBs
NCBI-GeneID: 885902
NCBI-ProteinID: NP_216963
TubercuList: Rv2447c
UniProt: I6Y0R5
Structure
PDB: 

Position
complement(2746135..2747598)
Genome map
AA seq 487 aa AA seqDB search
MNSTNSGPPDSGSATGVVPTPDEIASLLQVEHLLDQRWPETRIDPSLTRISALMDLLGSP
QRSYPSIHIAGTNGKTSVARMVDALVTALHRRTGRTTSPHLQSPVERISIDGKPISPAQY
VATYREIEPLVALIDQQSQASAGKGGPAMSKFEVLTAMAFAAFADAPVDVAVVEVGMGGR
WDATNVINAPVAVITPISIDHVDYLGADIAGIAGEKAGIITRAPDGSPDTVAVIGRQVPK
VMEVLLAESVRADASVAREDSEFAVLRRQIAVGGQVLQLQGLGGVYSDIYLPLHGEHQAH
NAVLALASVEAFFGAGAQRQLDGDAVRAGFAAVTSPGRLERMRSAPTVFIDAAHNPAGAS
ALAQTLAHEFDFRFLVGVLSVLGDKDVDGILAALEPVFDSVVVTHNGSPRALDVEALALA
AGERFGPDRVRTAENLRDAIDVATSLVDDAAADPDVAGDAFSRTGIVITGSVVTAGAART
LFGRDPQ
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaattcgacgaattccggcccgcctgactcgggatcggccaccggcgtcgtgcccact
ccggacgagatcgcgtccctgctgcaggttgagcatctactcgaccaacgctggccggag
acccgcatcgatccgagcctgacccggatcagcgcgttgatggacctgctgggctcgccc
caacgcagctatccgtcgatccatatcgcgggcaccaacggcaagacctcggtggcgcgc
atggtcgacgcgctggtcaccgcgctgcaccggcgcaccggccgaaccaccagcccacac
ctgcagtcaccggtggaacgcatttcgatcgacggcaagccgatcagcccggcgcagtat
gtggcgacctaccgggagatcgagccgttggtggcgctgatcgaccagcagtcgcaggct
tctgcgggtaagggtggcccggcgatgagcaagttcgaggtgctcaccgcgatggcgttc
gcggcctttgcggacgcgcccgtcgacgtggcagtggtcgaggtgggcatgggcggacgt
tgggacgccaccaacgtgatcaacgcaccggtcgccgtcatcaccccgatcagcattgat
cacgtcgactatctcggtgccgatatcgccgggatcgccggggagaaggcgggcatcatc
actcgggcccccgacggttcgccggacaccgtcgcggtcatcgggcgtcaggtcccgaag
gtcatggaggtgctgctggccgaatcggtgcgcgccgacgcgtcggtggcccgggaggat
tccgaattcgcggtgctacggcgacagatcgcggtcggcggtcaggtactgcaactgcag
ggcctcggcggggtttactccgacatctacttgccgctgcacggtgaacaccaggcgcac
aacgcggtgctcgccctcgcttccgtcgaggcctttttcggtgccggtgcgcagcgtcag
ctcgacggcgacgccgtccgggccggctttgccgccgtcaccagtcccggccggttggag
cgcatgcgcagcgcacccacggtgttcatcgacgccgcgcacaatccggccggggcgagt
gctctggcacaaacgctggcgcatgagttcgacttccgatttctggtcggggtgctcagc
gtgctgggcgacaaggacgtggacggcatcctggccgcactggagccggtgttcgattcc
gtcgtcgtgacccacaacgggtcgccgcgggcgctggatgtcgaggccctggcgctggcg
gccggcgagcggttcggacccgaccgggtgcgcaccgccgagaacctgcgcgatgctatc
gacgttgccacctcactggtcgacgacgccgccgccgacccggatgtggccggggacgca
ttctcgagaaccgggatcgtcatcaccggctcggttgtcaccgcaggggcggctcggacc
ttgttcggtcgtgatccgcaatga

DBGET integrated database retrieval system