KEGG   Mycobacterium tuberculosis H37Rv: Rv2453cHelp
Entry
Rv2453c           CDS       T00015                                 

Gene name
mobA
Definition
(RefSeq) molybdenum cofactor guanylyltransferase
  KO
K03752  molybdenum cofactor guanylyltransferase [EC:2.7.7.77]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00790  Folate biosynthesis
mtu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rv2453c (mobA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.77  molybdenum cofactor guanylyltransferase
     Rv2453c (mobA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transf_3
Motif
Other DBs
NCBI-GeneID: 885904
NCBI-ProteinID: NP_216969
TubercuList: Rv2453c
UniProt: P9WJQ9 I6XEC8
Position
complement(2753018..2753623)
Genome map
AA seq 201 aa AA seqDB search
MAELAPDTVPLAGVVLAGGESRRMGRDKATLPLPGGTTTLVEHMVGILGQRCAPVFVMAA
PGQPLPTLPVPVLRDELPGLGPLPATGRGLRAAAEAGVRLAFVCAVDMPYLTVELIEDLA
RRAVQTDAEVVLPWDGRNHYLAAVYRTDLADRVDTLVGAGERKMSALVDASDALRIVMAD
SRPLTNVNSAAGLHAPMQPGR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtggctgagctcgcgcccgacacagtgccgctggccggggttgttctcgcgggaggtgaa
tcccgccgaatgggtcgcgacaaagccaccctgcccctccccgggggaaccaccacgctg
gtggagcatatggtcggcattctcggccagcgctgcgcgccggttttcgtgatggccgct
ccgggacaaccgttgcccacgctgccggtccccgttctgcgtgatgagctgccggggctg
gggccgctgccggcgaccggtcgcgggttgcgtgcggctgcggaggccggtgtccggctc
gcgtttgtctgtgcggtcgacatgccttatctgacagtggaattgatcgaggatctcgcg
cgccgcgcggtgcagaccgatgccgaagtggtgttgccctgggatggccgtaaccactac
ctggccgcggtgtatcggacggatctggccgaccgcgtcgacacgttggtcggtgccggc
gagcgaaagatgagcgccctggtcgacgcttcggatgcactgcggatcgtgatggcggat
tcccgaccgctgaccaacgtcaattcggccgcaggcttgcacgcaccgatgcagcccgga
cgctaa

DBGET integrated database retrieval system