KEGG   Mycobacterium tuberculosis H37Rv: Rv2482cHelp
Entry
Rv2482c           CDS       T00015                                 

Gene name
plsB2
Definition
(RefSeq) glycerol-3-phosphate acyltransferase
  KO
K00631  glycerol-3-phosphate O-acyltransferase [EC:2.3.1.15]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00561  Glycerolipid metabolism
mtu00564  Glycerophospholipid metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    Rv2482c (plsB2)
   00564 Glycerophospholipid metabolism
    Rv2482c (plsB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mtu01004]
    Rv2482c (plsB2)
Enzymes [BR:mtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.15  glycerol-3-phosphate 1-O-acyltransferase
     Rv2482c (plsB2)
Lipid biosynthesis proteins [BR:mtu01004]
 Phospholipid acyltransferase
  GPAT
   Rv2482c (plsB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyltransferase
Motif
Other DBs
NCBI-GeneID: 887848
NCBI-ProteinID: NP_216998
TubercuList: Rv2482c
UniProt: P9WI61 I6XEE8
Position
complement(2786914..2789283)
Genome map
AA seq 789 aa AA seqDB search
MTKPAADASAVLTAEDTLVLASTATPVEMELIMGWLGQQRARHPDSKFDILKLPPRNAPP
AALTALVEQLEPGFASSPQSGEDRSIVPVRVIWLPPADRSRAGKVAALLPGRDPYHPSQR
QQRRILRTDPRRARVVAGESAKVSELRQQWRDTTVAEHKRDFAQFVSRRALLALARAEYR
ILGPQYKSPRLVKPEMLASARFRAGLDRIPGATVEDAGKMLDELSTGWSQVSVDLVSVLG
RLASRGFDPEFDYDEYQVAAMRAALEAHPAVLLFSHRSYIDGVVVPVAMQDNRLPPVHMF
GGINLSFGLMGPLMRRSGMIFIRRNIGNDPLYKYVLKEYVGYVVEKRFNLSWSIEGTRSR
TGKMLPPKLGLMSYVADAYLDGRSDDILLQGVSICFDQLHEITEYAAYARGAEKTPEGLR
WLYNFIKAQGERNFGKIYVRFPEAVSMRQYLGAPHGELTQDPAAKRLALQKMSFEVAWRI
LQATPVTATGLVSALLLTTRGTALTLDQLHHTLQDSLDYLERKQSPVSTSALRLRSREGV
RAAADALSNGHPVTRVDSGREPVWYIAPDDEHAAAFYRNSVIHAFLETSIVELALAHAKH
AEGDRVAAFWAQAMRLRDLLKFDFYFADSTAFRANIAQEMAWHQDWEDHLGVGGNEIDAM
LYAKRPLMSDAMLRVFFEAYEIVADVLRDAPPDIGPEELTELALGLGRQFVAQGRVRSSE
PVSTLLFATARQVAVDQELIAPAADLAERRVAFRRELRNILRDFDYVEQIARNQFVACEF
KARQGRDRI
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaaaccggcggccgatgccagcgcggtgcttactgccgaggacacactggtgctg
gcttccacggcgacgccggtcgagatggagctgatcatgggctggctgggccagcagcgt
gcacgccatccggactcgaagttcgacatattgaagctgccaccgcgcaacgctccgccg
gcggcgctgacggcactggtcgagcagctcgagcccggcttcgcatccagcccgcaatct
ggcgaggaccgttctatcgtgccggttcgggtgatctggctgcctcccgccgatcgcagc
cgggcgggcaaggtggccgcactgctcccgggtcgggatccctaccatcccagccagcgt
cagcagcgtcgcatcctgcgtaccgatcccaggcgcgcgcgggtggtggccggcgagtcg
gccaaggtgtccgaactgcgccagcagtggcgcgataccacggtggcagagcacaagcgc
gatttcgcccagttcgtcagccgccgagcgctgttggcgctggcgcgcgccgaatatcgg
atccttggaccgcaatacaaatctccccggctggtgaagccggagatgttggcgtccgca
cgatttcgtgccggcctggaccggattccgggcgccacggtcgaagatgccgggaagatg
ctcgacgaactctccaccggatggagccaggtgtcggtagacctggtttccgtcctcggc
aggctggctagccgcggcttcgatccggaattcgactacgacgagtatcaggtcgcggcg
atgcgcgccgcactggaggctcatccggcggtcctgctgttctcgcaccggtcctacatc
gacggcgtggtggtaccggtggccatgcaggacaaccggttaccgccggtgcacatgttc
ggcggcatcaacctgtcgttcggtctcatgggacccctcatgcggcgctcggggatgatc
ttcatccggcgcaatatcggcaacgacccactgtataagtacgtgctcaaggagtacgtg
ggctacgtggtcgagaagcggttcaacctgagctggtccatcgaaggcacccggtcgcgc
accggaaagatgttgccgcccaagctcggtttgatgagctacgtggccgatgcttacctg
gacggccgcagtgacgacatcctgctgcagggggtttcgatttgcttcgatcagctgcac
gagatcaccgaatacgccgcctacgcgcgtggcgcggagaagacgcccgaaggtttgcgc
tggctctacaacttcatcaaggcgcagggggaacgcaacttcggcaagatctacgttcgc
ttccccgaagcggtctcgatgcgccagtacctcggcgcaccgcacggcgagctgacccag
gatccggccgcgaaacggcttgcgttgcagaagatgtcgttcgaggtggcctggaggatt
ttgcaggcgacgccggtgaccgcgacgggtttggtgtccgcactgctgctcaccacccgc
ggcaccgcgttgacgctcgaccagctgcaccacacgttgcaggactcactggactatctg
gaacgcaaacaatcgccggtttcgacaagcgcattgcgactgcgctcgcgcgaaggcgtc
cgtgcggcggcggacgcgttgtccaacggccacccggtcactcgggtcgacagtggccgg
gagccggtatggtacatagcgcctgacgacgagcacgccgcggcgttctaccggaactcg
gtgatccatgcgtttttggagacctcgatcgtcgagctcgcgctggcccatgccaagcac
gccgaaggtgaccgcgtcgccgcgttctgggcccaggcgatgcggttgcgggatctgctg
aagttcgacttctatttcgcggattccacggcgtttcgggccaacatcgcccaagagatg
gcctggcaccaagactgggaggatcatcttggcgtcgggggcaatgagatcgacgcgatg
ctgtatgccaaacggccgctgatgtcggacgcgatgttgcgggtcttcttcgaagcctat
gagatcgttgccgacgtgttgcgcgatgctccgcctgacatcggtcctgaggagttgacg
gagctggcgctcggcctcggccgtcagtttgtggcacagggccgggtccgcagcagcgaa
ccggtatcgacgctgctgttcgccactgcacgccaggtcgccgtcgatcaggagctgata
gcgccggcggccgacctcgccgaacgtagggtcgccttccggcgggagttacgaaacatt
ctgcgggatttcgactatgtcgagcagatcgcgcgcaaccagttcgtcgcctgcgagttc
aaagcgcgtcaaggacgcgaccgaatctaa

DBGET integrated database retrieval system