KEGG   Mycobacterium tuberculosis H37Rv: Rv2495cHelp
Entry
Rv2495c           CDS       T00015                                 

Gene name
bkdC
Definition
(RefSeq) branched-chain keto acid dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00010  Glycolysis / Gluconeogenesis
mtu00020  Citrate cycle (TCA cycle)
mtu00620  Pyruvate metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
Module
mtu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rv2495c (bkdC)
   00020 Citrate cycle (TCA cycle)
    Rv2495c (bkdC)
   00620 Pyruvate metabolism
    Rv2495c (bkdC)
Enzymes [BR:mtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Rv2495c (bkdC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 Ribosomal_L13
Motif
Other DBs
NCBI-GeneID: 888237
NCBI-ProteinID: NP_217011
TubercuList: Rv2495c
UniProt: O06159
Structure
PDB: 

Position
complement(2808758..2809939)
Genome map
AA seq 393 aa AA seqDB search
MSGEDSIRSFPVPDLGEGLQEVTVTCWSVAVGDDVEINQTLCSVETAKAEVEIPSPYAGR
IVELGGAEGDVLKVGAELVRIDTGPTAVAQPNGEGAVPTLVGYGADTAIETSRRTSRPLA
APVVRKLAKELAVDLAALQRGSGAGGVITRADVLAAARGGVGAGPDVRPVHGVHARMAEK
MTLSHKEIPTAKASVEVICAELLRLRDRFVSAAPEITPFALTLRLLVIALKHNVILNSTW
VDSGEGPQVHVHRGVHLGFGAATERGLLVPVVTDAQDKNTRELASRVAELITGAREGTLT
PAELRGSTFTVSNFGALGVDDGVPVINHPEAAILGLGAIKPRPVVVGGEVVARPTMTLTC
VFDHRVVDGAQVAQFMCELRDLIESPETALLDL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtgaggacagcatcaggtctttcccggtgcccgacctcggcgagggactgcag
gaagtgacggtgacgtgttggagcgtcgccgtcggcgacgatgtggagatcaaccagacg
ctgtgttcggtggagaccgccaaggccgaggtcgaaatccccagcccgtatgccggccgg
atcgtcgagttaggcggcgccgaaggcgatgtgctcaaagtgggcgcggagctagttcgg
atcgacaccgggcccacggcagttgcgcagcctaacggtgaaggagcggtccccacgttg
gtcggctacggtgccgacaccgcgatcgaaaccagtagacggacaagccggccgctggcg
gcaccggtagtgcgcaagctggccaaagagttggcggtcgacctggccgcattgcagcgt
gggtcgggcgccggcggtgtgatcacccgggccgatgtgctggccgctgctcgaggcggc
gtcggagccgggccggacgtgcggccggtccacggcgtgcacgcgcggatggccgaaaaa
atgacgttgtcccacaaggagattccgaccgcaaaggccagcgttgaggtaatttgcgcc
gaactgctgcggctgcgcgaccggttcgtttcggcggcgcccgagattacaccgttcgcg
ctgacgctgcggctgctggttattgcattgaaacacaacgtaattctcaactcgacgtgg
gtcgactcgggcgaaggcccgcaagtacacgtgcatcgcggtgtgcatctggggttcggc
gcggccactgagcgtggattgctggtgccggtggtgaccgacgcccaggacaagaacacc
cgcgaacttgcctcccgcgtagcggaattaatcaccggcgcacgtgaaggcactctcaca
cccgcggagctgcgcggttcgacgttcacggtgtcgaacttcggggcgctgggagtcgac
gacggcgtgccggtgatcaaccatcccgaagcggcgatcctgggtctgggggcgatcaag
ccgcgcccggtggtcgtcggcggcgaggttgtcgcacggccgacgatgacgttgacttgt
gtgttcgaccaccgcgttgtcgatggtgctcaggtggcccagttcatgtgtgagctgcgg
gatctgatcgagtcgccggagaccgcgctgttggatctgtag

DBGET integrated database retrieval system