KEGG   Mycobacterium tuberculosis H37Rv: Rv2496cHelp
Entry
Rv2496c           CDS       T00015                                 

Gene name
bkdB
Definition
(RefSeq) 3-methyl-2-oxobutanoate dehydrogenase subunit beta
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00010  Glycolysis / Gluconeogenesis
mtu00020  Citrate cycle (TCA cycle)
mtu00620  Pyruvate metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
Module
mtu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rv2496c (bkdB)
   00020 Citrate cycle (TCA cycle)
    Rv2496c (bkdB)
   00620 Pyruvate metabolism
    Rv2496c (bkdB)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     Rv2496c (bkdB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr Transketolase_C
Motif
Other DBs
NCBI-GeneID: 888571
NCBI-ProteinID: NP_217012
TubercuList: Rv2496c
UniProt: P9WIS1 I6XEG1
Position
complement(2809936..2810982)
Genome map
AA seq 348 aa AA seqDB search
MTQIADRPARPDETLAVAVSDITQSLTMVQAINRALYDAMAADERVLVFGEDVAVEGGVF
RVTEGLADTFGADRCFDTPLAESAIIGIAVGLALRGFVPVPEIQFDGFSYPAFDQVVSHL
AKYRTRTRGEVDMPVTVRIPSFGGIGAAEHHSDSTESYWVHTAGLKVVVPSTPGDAYWLL
RHAIACPDPVMYLEPKRRYHGRGMVDTSRPEPPIGHAMVRRSGTDVTVVTYGNLVSTALS
SADTAEQQHDWSLEVIDLRSLAPLDFDTIAASIQRTGRCVVMHEGPRSLGYGAGLAARIQ
EEMFYQLEAPVLRACGFDTPYPPARLEKLWLPGPDRLLDCVERVLRQP
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaatcgcagaccgtccggccaggccggatgagacgcttgcggtagcggtgagc
gacatcacgcagtcgttgaccatggtccaggcgatcaaccgcgccctgtacgacgcgatg
gccgccgacgagcgggtattggtgtttggcgaggatgtcgcggtcgagggtggggtgttt
cgggtgaccgagggactggccgatacgttcggtgcagaccggtgcttcgacacgccactg
gcggagtccgcgatcatcggaatagccgtcgggttggcactacgtggctttgtgccggtg
ccagaaatccagttcgacggcttttcctatccggctttcgaccaagtggtgagccatctg
gccaagtaccggactcgcacccgcggtgaggtggacatgccggtgaccgtccggatcccc
tcgtttggcggtatcggtgcggccgaacatcattcggactccacggagtcctactgggtg
cacaccgcgggcctcaaggtggtggtgccgtcgacacccggtgacgcttactggctgctg
cggcacgctatcgcctgcccggaccccgtgatgtatctggagcccaaacgccgctaccac
ggccgcgggatggtcgacactagccggccggaaccgccgatcgggcacgcgatggtgcgc
cggtccggcaccgatgtgaccgtggtaacgtacggaaacctggtgagcaccgccctgtct
agcgcggatactgcagagcagcaacatgattggagtctggaggttatcgatctgcggtcg
ttggcgccgctggacttcgacaccattgctgcgtcgatccagcgcaccgggcgttgcgtg
gtgatgcacgaagggccgcgcagcctcggctatggtgccggtctggccgcgcgcatccag
gaagagatgttctaccaattggaggctccggtgttgcgtgcctgcggttttgacacaccc
tacccgcctgcgcggttggaaaaattgtggttacccggccccgaccggctgttggactgc
gtcgaacgtgtgctgcgtcagccatga

DBGET integrated database retrieval system