KEGG   Mycobacterium tuberculosis H37Rv: Rv2497cHelp
Entry
Rv2497c           CDS       T00015                                 

Gene name
bkdA
Definition
(RefSeq) 3-methyl-2-oxobutanoate dehydrogenase subunit alpha
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00010  Glycolysis / Gluconeogenesis
mtu00020  Citrate cycle (TCA cycle)
mtu00620  Pyruvate metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
Module
mtu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rv2497c (bkdA)
   00020 Citrate cycle (TCA cycle)
    Rv2497c (bkdA)
   00620 Pyruvate metabolism
    Rv2497c (bkdA)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     Rv2497c (bkdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh DXP_synthase_N TPP_enzyme_C Transketolase_N
Motif
Other DBs
NCBI-GeneID: 888583
NCBI-ProteinID: NP_217013
TubercuList: Rv2497c
UniProt: P9WIS3 I6YDK3
Position
complement(2810993..2812096)
Genome map
AA seq 367 aa AA seqDB search
MGEGSRRPSGMLMSVDLEPVQLVGPDGTPTAERRYHRDLPEETLRWLYEMMVVTRELDTE
FVNLQRQGELALYTPCRGQEAAQVGAAACLRKTDWLFPQYRELGVYLVRGIPPGHVGVAW
RGTWHGGLQFTTKCCAPMSVPIGTQTLHAVGAAMAAQRLDEDSVTVAFLGDGATSEGDVH
EALNFAAVFTTPCVFYVQNNQWAISMPVSRQTAAPSIAHKAIGYGMPGIRVDGNDVLACY
AVMAEAAARARAGDGPTLIEAVTYRLGPHTTADDPTRYRSQEEVDRWATLDPIPRYRTYL
QDQGLWSQRLEEQVTARAKHVRSELRDAVFDAPDFDVDEVFTTVYAEITPGLQAQREQLR
AELARTD
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgggggagggttctcggaggccatctgggatgttgatgtctgtcgatcttgagccggtg
caactcgtcggcccggacggtacgccgacggccgaacgccgctaccaccgtgaccttcct
gaggaaacgctgcgttggctctacgagatgatggtggtcacccgcgagctggataccgaa
ttcgtcaatctgcagcgccagggggagctggcgttgtacacgccctgtcgcgggcaggaa
gccgcgcaggtgggtgcggcggcttgcctacgcaaaaccgactggttgttcccccaatac
cgagaattgggcgtctacctagtgcgtggcatcccgcctggacatgttggggtcgcgtgg
cgtggaacctggcacggcgggctgcaattcaccacgaagtgctgtgcaccgatgtcggtt
cccatcggcacccagaccttgcacgcggtgggcgcggcgatggccgcgcaacgcctggac
gaggactccgtgacggtggcctttctgggcgacggcgccaccagcgagggcgacgtacat
gaggcgctcaatttcgcggcggtgttcaccacaccgtgcgtgttctacgtgcagaacaac
cagtgggcaatctcgatgccggtatccaggcagaccgccgcaccatctatcgcgcacaag
gcgattggctacgggatgccaggcatccgggtggacggcaacgacgtgctggcatgctat
gcggtgatggccgaagctgccgctcgggctcgggccggcgacggtccaacgctgatcgag
gcggtcacttaccgtcttggtccgcacaccaccgccgatgatccaacccggtaccgcagc
caggaggaggtggaccgctgggcgacgctggacccgattccgcgctatcgcacttactta
caagatcagggcctgtggtcgcaacgcctcgaggaacaggtgacggctcgggcaaaacac
gtgcggtccgagctacgcgacgcggtctttgatgcgcctgacttcgacgtcgatgaggtg
ttcaccacggtgtacgccgaaatcacacccgggttgcaggcgcagcgcgaacagctgcgt
gccgaactggcgcggactgactga

DBGET integrated database retrieval system