KEGG   Mycobacterium tuberculosis H37Rv: Rv2501cHelp
Entry
Rv2501c           CDS       T00015                                 

Gene name
accA1
Definition
(RefSeq) acetyl/propionyl-CoA carboxylase subuit alpha
  KO
K11263  acetyl-CoA/propionyl-CoA carboxylase, biotin carboxylase, biotin carboxyl carrier protein [EC:6.4.1.2 6.4.1.3 6.3.4.14]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00061  Fatty acid biosynthesis
mtu00280  Valine, leucine and isoleucine degradation
mtu00620  Pyruvate metabolism
mtu00630  Glyoxylate and dicarboxylate metabolism
mtu00640  Propanoate metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
mtu01212  Fatty acid metabolism
Module
mtu_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rv2501c (accA1)
   00630 Glyoxylate and dicarboxylate metabolism
    Rv2501c (accA1)
   00640 Propanoate metabolism
    Rv2501c (accA1)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Rv2501c (accA1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rv2501c (accA1)
Enzymes [BR:mtu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     Rv2501c (accA1)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Rv2501c (accA1)
    6.4.1.3  propionyl-CoA carboxylase
     Rv2501c (accA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl Dala_Dala_lig_C ATPgrasp_Ter ATP-grasp Biotin_lipoyl_2 ATP-grasp_3 GCV_H PASTA Peptidase_M23
Motif
Other DBs
NCBI-GeneID: 887309
NCBI-ProteinID: NP_217017
TubercuList: Rv2501c
UniProt: P9WPQ3 I6XEG5
Position
complement(2814916..2816880)
Genome map
AA seq 654 aa AA seqDB search
MFDTVLVANRGEIAVRVIRTLRRLGIRSVAVYSDPDVDARHVLEADAAVRLGPAPARESY
LDIGKVLDAAARTGAQAIHPGYGFLAENADFAAACERARVVFLGPPARAIEVMGDKIAAK
NAVAAFDVPVVPGVARAGLTDDALVTAAAEVGYPVLIKPSAGGGGKGMRLVQDPARLPEA
LVSARREAMSSFGDDTLFLERFVLRPRHIEVQVLADAHGNVVHLGERECSLQRRHQKVIE
EAPSPLLDPQTRERIGVAACNTARCVDYVGAGTVEFIVSAQRPDEFFFMEMNTRLQVEHP
VTEAITGLDLVEWQLRVGAGEKLGFAQNDIELRGHAIEARVYAEDPAREFLPTGGRVLAV
FEPAGPGVRVDSSLLGGTVVGSDYDPLLTKVIAHGADREEALDRLDQALARTAVLGVQTN
VEFLRFLLADERVRVGDLDTAVLDERSADFTARPAPDDVLAAGGLYRQWALARRAQGDLW
AAPSGWRGGGHMAPVRTAMRTPLRSETVSVWGPPESAQVQVGDGEIDCASVQVTREQMSV
TISGLRRDYRWAEADRHLWIADERGTWHLREAEEHKIHRAVGARPAEVVSPMPGSVIAVQ
VESGSQISAGDVVVVVEAMKMEHSLEAPVSGRVQVLVSVGDQVKVEQVLARIKD
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgtttgacaccgtactagtggccaaccgcggtgagatcgcggttcgggtgattcggacg
ctgcgccggctaggcatccggtcggtcgcggtctacagcgaccccgacgtcgatgcccgc
cacgtcttggaggcggacgctgcggtgcggctggggcccgccccagcacgcgaaagctac
ctcgatatcggcaaggtgctcgatgctgcggcgcgcaccggagcccaggcgatccatccg
ggctacgggtttcttgccgagaatgccgatttcgctgcggcgtgtgaacgcgcccgggtg
gtgttcctgggtccgccggcgcgcgcgatcgaggtgatgggcgacaagatcgccgccaag
aacgcggtcgccgctttcgatgttccggtggtgcccggtgtggcgcgcgccgggctgacg
gacgacgcgctggtcaccgctgccgctgaggtgggctatccggtgctgatcaaaccgtcg
gccggcggcggcggcaaagggatgcggttagtgcaagatccggcgcggctgcctgaggcg
ctggtgagtgcccggcgcgaagccatgtcttcgttcggggacgatacgctattcctggag
cggtttgtgttgcggcccaggcacatcgaagtgcaggtgcttgccgacgctcacggcaac
gtggtgcatctgggtgagcgtgagtgcagcctccagcggcgccaccagaaggttatcgag
gaggcgccgtcgccactgcttgacccgcagacccgcgagcgcatcggggtcgcggcctgc
aacaccgcccgctgcgtggactacgtcggcgccggcacggtggagttcatcgtctccgcg
cagcgccccgacgagttctttttcatggagatgaatacccggctgcaggtggaacacccg
gtcaccgaggcgattactggattggacctggtcgagtggcagttgcgggtgggtgcgggc
gaaaagttgggcttcgcccaaaacgacatcgagctgcgtgggcacgcgatcgaggctcgg
gtgtatgcggaggatcccgcgcgggaattcctgcccaccggcggccgggtgctggcggtg
ttcgaacccgccggccccggggtgcgggtggattcgtcactgctaggcggcacggtggtc
ggcagtgattacgacccgttgctcaccaaggtgattgcgcacggggccgatcgcgaggaa
gcgctggatcggctggaccaggcgctggcgcggactgcggtgctgggagtgcagaccaat
gtcgagttccttcgctttctgctcgccgacgagcgggtgcgggtcggggatttggacacc
gctgtactggacgagcgatcggccgatttcactgcgcggccggcgcctgacgacgtgcta
gctgccggcggcctctaccgccagtgggccctggcccggcgcgcacagggcgacctgtgg
gccgcgccgtccggatggcgcggcgggggccatatggcaccggtccgcaccgccatgcgc
accccgctgcgcagcgagaccgtttcggtgtgggggccacccgagtcggcgcaggttcag
gttggcgatggtgagatcgattgtgcgagcgtgcaggtcacccgagaacagatgagcgtg
acgataagcgggctgcgccgggattatcggtgggcagaggctgaccggcacctgtggatc
gccgacgagcgcgggacttggcacctgcgcgaggccgaggagcacaagattcaccgcgcc
gtgggtgcgcggccggcggaggtcgtcagccctatgcctggcagcgtgatcgccgtgcag
gtcgagtccggctcccagatctctgcgggtgatgtggtggtggtggtggaagcgatgaag
atggagcactcgctggaggcgccggtttcgggacgggtacaggtgttggtgtccgttggc
gatcaggtgaaagtcgaacaggtactggcgaggatcaaggactag

DBGET integrated database retrieval system