KEGG   Mycobacterium tuberculosis H37Rv: Rv2524cHelp
Entry
Rv2524c           CDS       T00015                                 

Gene name
fas
Definition
(RefSeq) fatty acid synthase
  KO
K11533  fatty acid synthase, bacteria type [EC:2.3.1.-]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00061  Fatty acid biosynthesis
mtu01100  Metabolic pathways
mtu01212  Fatty acid metabolism
Module
mtu_M00082  Fatty acid biosynthesis, initiation
mtu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Rv2524c (fas)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mtu01004]
    Rv2524c (fas)
Enzymes [BR:mtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     Rv2524c (fas)
Lipid biosynthesis proteins [BR:mtu01004]
 Fatty acid synthase
  Bacteria type
   Rv2524c (fas)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1729 Acyl_transf_1 ketoacyl-synt MaoC_dehydratas Ketoacyl-synt_C DNA_pol_B_N Fas_alpha_ACP FAS_I_H adh_short MaoC_dehydrat_N
Motif
Other DBs
NCBI-GeneID: 887704
NCBI-ProteinID: NP_217040
TubercuList: Rv2524c
UniProt: A0A089S8C7 P95029
Position
complement(2840123..2849332)
Genome map
AA seq 3069 aa AA seqDB search
MTIHEHDRVSADRGGDSPHTTHALVDRLMAGEPYAVAFGGQGSAWLETLEELVSATGIET
ELATLVGEAELLLDPVTDELIVVRPIGFEPLQWVRALAAEDPVPSDKHLTSAAVSVPGVL
LTQIAATRALARQGMDLVATPPVAMAGHSQGVLAVEALKAGGARDVELFALAQLIGAAGT
LVARRRGISVLGDRPPMVSVTNADPERIGRLLDEFAQDVRTVLPPVLSIRNGRRAVVITG
TPEQLSRFELYCRQISEKEEADRKNKVRGGDVFSPVFEPVQVEVGFHTPRLSDGIDIVAG
WAEKAGLDVALARELADAILIRKVDWVDEITRVHAAGARWILDLGPGDILTRLTAPVIRG
LGIGIVPAATRGGQRNLFTVGATPEVARAWSSYAPTVVRLPDGRVKLSTKFTRLTGRSPI
LLAGMTPTTVDAKIVAAAANAGHWAELAGGGQVTEEIFGNRIEQMAGLLEPGRTYQFNAL
FLDPYLWKLQVGGKRLVQKARQSGAAIDGVVISAGIPDLDEAVELIDELGDIGISHVVFK
PGTIEQIRSVIRIATEVPTKPVIMHVEGGRAGGHHSWEDLDDLLLATYSELRSRANITVC
VGGGIGTPRRAAEYLSGRWAQAYGFPLMPIDGILVGTAAMATKESTTSPSVKRMLVDTQG
TDQWISAGKAQGGMASSRSQLGADIHEIDNSASRCGRLLDEVAGDAEAVAERRDEIIAAM
AKTAKPYFGDVADMTYLQWLRRYVELAIGEGNSTADTASVGSPWLADTWRDRFEQMLQRA
EARLHPQDFGPIQTLFTDAGLLDNPQQAIAALLARYPDAETVQLHPADVPFFVTLCKTLG
KPVNFVPVIDQDVRRWWRSDSLWQAHDARYDADAVCIIPGTASVAGITRMDEPVGELLDR
FEQAAIDEVLGAGVEPKDVASRRLGRADVAGPLAVVLDAPDVRWAGRTVTNPVHRIADPA
EWQVHDGPENPRATHSSTGARLQTHGDDVALSVPVSGTWVDIRFTLPANTVDGGTPVIAT
EDATSAMRTVLAIAAGVDSPEFLPAVANGTATLTVDWHPERVADHTGVTATFGEPLAPSL
TNVPDALVGPCWPAVFAAIGSAVTDTGEPVVEGLLSLVHLDHAARVVGQLPTVPAQLTVT
ATAANATDTDMGRVVPVSVVVTGADGAVIATLEERFAILGRTGSAELADPARAGGAVSAN
ATDTPRRRRRDVTITAPVDMRPFAVVSGDHNPIHTDRAAALLAGLESPIVHGMWLSAAAQ
HAVTATDGQARPPARLVGWTARFLGMVRPGDEVDFRVERVGIDQGAEIVDVAARVGSDLV
MSASARLAAPKTVYAFPGQGIQHKGMGMEVRARSKAARKVWDTADKFTRDTLGFSVLHVV
RDNPTSIIASGVHYHHPDGVLYLTQFTQVAMATVAAAQVAEMREQGAFVEGAIACGHSVG
EYTALACVTGIYQLEALLEMVFHRGSKMHDIVPRDELGRSNYRLAAIRPSQIDLDDADVP
AFVAGIAESTGEFLEIVNFNLRGSQYAIAGTVRGLEALEAEVERRRELTGGRRSFILVPG
IDVPFHSRVLRVGVAEFRRSLDRVMPRDADPDLIIGRYIPNLVPRLFTLDRDFIQEIRDL
VPAEPLDEILADYDTWLRERPREMARTVFIELLAWQFASPVRWIETQDLLFIEEAAGGLG
VERFVEIGVKSSPTVAGLATNTLKLPEYAHSTVEVLNAERDAAVLFATDTDPEPEPEEDE
PVAESPAPDVVSEAAPVAPAASSAGPRPDDLVFDAADATLALIALSAKMRIDQIEELDSI
ESITDGASSRRNQLLVDLGSELNLGAIDGAAESDLAGLRSQVTKLARTYKPYGPVLSDAI
NDQLRTVLGPSGKRPGAIAERVKKTWELGEGWAKHVTVEVALGTREGSSVRGGAMGHLHE
GALADAASVDKVIDAAVASVAARQGVSVALPSAGSGGGATIDAAALSEFTDQITGREGVL
ASAARLVLGQLGLDDPVNALPAAPDSELIDLVTAELGADWPRLVAPVFDPKKAVVFDDRW
ASAREDLVKLWLTDEGDIDADWPRLAERFEGAGHVVATQATWWQGKSLAAGRQIHASLYG
RIAAGAENPEPGRYGGEVAVVTGASKGSIAASVVARLLDGGATVIATTSKLDEERLAFYR
TLYRDHARYGAALWLVAANMASYSDVDALVEWIGTEQTESLGPQSIHIKDAQTPTLLFPF
AAPRVVGDLSEAGSRAEMEMKVLLWAVQRLIGGLSTIGAERDIASRLHVVLPGSPNRGMF
GGDGAYGEAKSALDAVVSRWHAESSWAARVSLAHALIGWTRGTGLMGHNDAIVAAVEEAG
VTTYSTDEMAALLLDLCDAESKVAAARSPIKADLTGGLAEANLDMAELAAKAREQMSAAA
AVDEDAEAPGAIAALPSPPRGFTPAPPPQWDDLDVDPADLVVIVGGAEIGPYGSSRTRFE
MEVENELSAAGVLELAWTTGLIRWEDDPQPGWYDTESGEMVDESELVQRYHDAVVQRVGI
REFVDDGAIDPDHASPLLVSVFLEKDFAFVVSSEADARAFVEFDPEHTVIRPVPDSTDWQ
VIRKAGTEIRVPRKTKLSRVVGGQIPTGFDPTVWGISADMAGSIDRLAVWNMVATVDAFL
SSGFSPAEVMRYVHPSLVANTQGTGMGGGTSMQTMYHGNLLGRNKPNDIFQEVLPNIIAA
HVVQSYVGSYGAMIHPVAACATAAVSVEEGVDKIRLGKAQLVVAGGLDDLTLEGIIGFGD
MAATADTSMMCGRGIHDSKFSRPNDRRRLGFVEAQGGGTILLARGDLALRMGLPVLAVVA
FAQSFGDGVHTSIPAPGLGALGAGRGGKDSPLARALAKLGVAADDVAVISKHDTSTLAND
PNETELHERLADALGRSEGAPLFVVSQKSLTGHAKGGAAVFQMMGLCQILRDGVIPPNRS
LDCVDDELAGSAHFVWVRDTLRLGGKFPLKAGMLTSLGFGHVSGLVALVHPQAFIASLDP
AQRADYQRRADARLLAGQRRLASAIAGGAPMYQRPGDRRFDHHAPERPQEASMLLNPAAR
LGDGEAYIG
NT seq 9210 nt NT seq  +upstreamnt  +downstreamnt
gtgacgatccacgagcacgaccgggtgtccgctgatcgcggcggggacagcccgcatacc
acccacgctctggtcgatcgcctcatggctggtgagccctacgctgtcgcattcggtggc
cagggcagcgcctggctggaaaccctcgaagagctggtgtcggccaccgggatagaaacc
gagttggcgacgttggtcggtgaggcagagctgttgctcgatccggtcaccgacgagctg
attgtggtgcgcccgatcggtttcgagccgctgcaatgggtacgcgcactggcggccgag
gacccggttccgtccgacaagcacctgacgtcggccgccgtgtcggtgcccggcgtgttg
cttacccagatcgcggcgacccgggcgctggcccgtcaaggcatggacctcgtggccacc
ccgccggtcgccatggcggggcattcgcaaggtgtgctggcggtggaagccctcaaggct
ggtggggcacgcgacgtcgagctgtttgccttggcccagttgatcggtgccgccggaacg
ctggtggcccgccggcgcggaatttccgtcctgggcgatcgcccgccgatggtatcggtc
accaacgccgaccccgagcgcatcggccggttgctcgacgagttcgcccaggacgtgcgc
acggtgctgccaccggtgttgtccatccgcaacggccggcgtgccgtcgtcatcaccggc
acccccgagcagctgtcgcgtttcgagctttattgccgccagatctccgagaaggaagaa
gccgaccgcaagaacaaggtccgcggcggcgacgtcttctcgccggtcttcgagccggtg
caggtggaggtgggctttcacaccccgcggctatccgacgggatcgacatcgtcgcgggc
tgggccgagaaggcgggcctcgatgtcgccttggctcgggagctggccgatgccatcttg
atcagaaaggtcgactgggtcgacgagatcacccgtgtccacgcggccggcgcccgctgg
atcctcgacctggggccgggcgacatcctgacccgactgaccgcaccggtgatccgcggc
ctgggcatcggcatcgtgccggcggctacccgcggtggccagcgcaacctgttcaccgtc
ggcgccacccccgaggttgcccgggcctggtcgagctacgcaccgaccgtggttcgcctc
cccgacggcagggtcaagctctcgacgaagttcacccggctgaccggccgctcgccgatc
ctgctcgcgggcatgaccccgaccaccgtggacgccaagatcgtcgccgcggcggccaac
gccgggcactgggccgagctggccggcggcgggcaggtcaccgaagagatcttcggtaac
cgcatcgaacaaatggccggcctgctcgagccgggccgcacctatcagttcaacgcgctg
ttcctcgatccctacctgtggaagcttcaggtgggcggcaagcggttggtgcagaaggcc
cgccagtccggcgccgcgatcgacggcgtggtgatcagcgccggcatcccagacctcgac
gaggccgtcgagctgatcgacgaactgggcgacatcggcatcagccacgtcgtgttcaaa
cccgggaccatcgagcagatccgctcggtgattcgcatcgccaccgaggtgcccaccaag
ccggtgatcatgcacgtcgagggcgggcgcgccggcgggcaccattcctgggaggatctc
gacgacctgctgctggctacctactcggagttgcgctcacgcgccaacatcacggtgtgc
gtcggcggcggcattggcaccccgagaagggctgcggaatatttgtccgggcgctgggcg
caggcctacggcttcccattgatgccgatcgacggcatcctggtcggcaccgcggcgatg
gccaccaaggaatccaccacgtcgccatcggtcaagcggatgctcgtcgacactcagggc
accgaccaatggatcagcgccggaaaagcgcagggcggcatggcctccagccgcagtcag
ctcggtgccgatatccacgagatcgacaacagcgcatcccggtgcgggcggctgctcgac
gaggtggccggtgacgcggaggcggtcgcggagcgtcgcgacgagatcatcgcggcgatg
gccaagaccgccaagccctacttcggcgacgtcgccgacatgacctacctgcagtggctg
cggcgctacgtcgaactggccatcggggaaggcaactcgaccgccgacaccgcctcggtg
ggcagcccgtggctggccgacacctggcgggaccgcttcgagcagatgctgcagcgtgcc
gaagcccggttgcacccacaggatttcggcccgatccagacgctattcaccgatgctggc
ctgctggacaatccgcagcaggcgatcgccgccctgctggcgcgctaccccgacgccgag
accgtgcagttgcatcccgcggatgtgccctttttcgtgacgttgtgcaagacgctgggc
aagccggtcaacttcgtgccggtgatcgaccaggacgtgcggcgctggtggcgcagcgac
tcgctgtggcaggcccacgacgcccgctacgacgccgatgcggtgtgcatcattccgggc
accgcgtcggtagccggcatcacccggatggatgaacccgtcggtgagttgctggaccgt
ttcgagcaagccgcaatcgatgaagtgctcggcgccggtgtcgagccgaaggatgtcgcg
tcgcgccggctgggccgcgccgacgtggccggaccgttggctgtcgtcctcgacgcaccc
gatgtgcgctgggccggtcgcaccgtgaccaacccggtgcatcggatcgccgacccggcc
gaatggcaggtgcacgatggacccgaaaacccgcgcgccacacactcatccaccggcgcc
cggctgcagacgcacggcgacgacgtcgccttgagcgtgcccgtctcgggcacctgggtc
gacatccgattcacgttgccggccaacaccgtcgatggcggcaccccggtgatcgccacc
gaggacgccaccagcgccatgcgcacggtgctggcgatcgccgccggtgtcgacagcccg
gagttcttgcctgcggtggccaacgggacggccactttgacggtggactggcaccccgag
cgtgttgccgaccacaccggcgtcaccgccacgttcggtgagccgctggcacccagcctc
accaacgtgcccgacgcgctcgtcggcccttgttggccagcggttttcgcggccatcgga
tcggcggtcaccgacaccggtgagccggtggtggaaggcctgctgagcctggtgcatctg
gaccacgccgcccgcgtggtcggtcagctgcccacggtcccggcccaattgaccgtcacc
gcaacggctgccaacgcaaccgatacggacatgggccgcgtcgtgccggtctcggtcgtc
gttaccggcgccgatggcgccgtgatcgccactctcgaggagcgattcgcgatcctgggt
cgcaccggttccgccgagctcgccgacccggcgcgagccggtggcgcggtgtcggcgaac
gccaccgacaccccgcgccgtcgccgccgcgacgtcacgatcaccgcgccggtcgacatg
cgcccgttcgcggtggtgtccggcgaccacaaccccattcacaccgaccgggccgccgcg
ctgcttgccggcctggagtcgccgatcgtgcacggcatgtggctgtcggccgcggcgcaa
cacgcggtgaccgccaccgacgggcaggcccggccaccggcccggctggtcggctggacc
gcgcggtttttgggcatggtgcgccccggcgacgaggtggacttccgcgtcgagcgcgtc
ggaatcgaccagggcgcagagattgtggacgtggccgcgcgcgtcgggtcggatctagtg
atgtcggcctccgcgcgactggccgcacccaagacggtctacgcattccccggccagggc
atccaacacaagggcatgggcatggaggtgcgcgcccgctccaaggcggcccgcaaggtg
tgggacaccgcggacaagttcacccgcgacaccctgggcttctcggtactgcacgtggtc
cgcgacaacccgaccagcatcatcgccagcggtgtgcactaccaccaccccgacggggtg
ctctacctgacgcagttcacccaggtcgcgatggcgacggtggcggccgcgcaggtcgcc
gagatgcgtgaacagggagccttcgtcgaaggcgccatcgcgtgcggccactcggtcggc
gagtacaccgcgctggcctgcgtgaccggcatctaccaactggaagccttgctggagatg
gtgtttcaccgcgggtcgaagatgcacgacatcgttccgcgcgacgagctcggccgctcc
aactatcggctggcggccatccggccgtcccagatcgacctcgacgacgccgacgtgccc
gcgttcgtcgccgggatcgcggagagcaccggtgaattcctggagatcgtgaatttcaac
ctgcgtggctcgcaatacgcgatcgcgggcacggtacgcggcctcgaggcgctcgaggcc
gaggtggagcggcgccgcgagctcaccggcggccgacggtcgttcattttggtgcccggc
atcgatgttccgttccactcgcgagtgctgcgggtcggggtggccgaattccggcgctcg
ctggaccgggtcatgccgcgcgacgcggaccccgacctgatcatcgggcgctacattccc
aacctggtgccgcggttgttcaccctggaccgcgacttcatccaggaaatccgggatttg
gtgcccgccgagccgctcgacgagatcctcgccgactacgacacctggcttcgcgagcgt
ccgcgcgagatggcgcgcacggtgttcatcgagctgctggcatggcaattcgccagcccg
gtgcgctggatcgagacgcaggatctgctgttcatcgaggaggccgccggcgggctgggt
gtggagcgattcgtcgagatcggtgtgaagagctcaccgacggtggcgggtcttgccacc
aacaccctcaaactgcccgaatacgcccacagcacagtggaagtgctcaacgccgagcgt
gatgccgcggtgctgttcgccaccgacaccgacccggagccggagccggaggaagacgag
ccggtcgcggaatcgcccgcgccggacgtcgtctcggaagccgcccccgtcgcgccggcc
gcttcgtcggcgggcccgcgtcccgacgatctggttttcgacgccgccgatgccacgctg
gcgctgatcgcgctctcggccaagatgcgcatcgaccagatcgaagaactcgactccatc
gagtccatcaccgacggtgcgtcgtcgcggcgcaaccagctgctggtggacctgggctcc
gagctgaacctcggtgccattgacggcgccgccgaatcggacctggccggtctgcgctca
caggtgaccaaactggcgcgcacctacaagccttacggcccagtgctttccgacgccatc
aacgaccagcttcgcaccgtcctcggaccgtcgggcaagcggcccggcgccatcgccgag
cgggtgaagaagacctgggagctcggtgagggctgggccaagcatgtcaccgtcgaggtc
gcgctgggcacccgcgagggcagcagcgttcgcggcggcgccatgggccacctgcacgag
ggcgcgctggccgatgccgcctccgtcgacaaggtcatcgacgcggcggtcgcatcggtg
gccgcgcgccagggcgtttcggtagcgctgccgtcggccggtagtggtggcggcgccacc
atcgacgcggccgcgctcagcgagttcaccgaccaaatcaccggccgtgagggcgtgctg
gcctccgcggcccgcctggtgctggggcagctgggactggacgaccccgtcaacgccttg
ccggccgcccccgattccgagctgatcgacttggtcaccgccgaactgggagcggactgg
ccgcggttggtggcaccggtgttcgaccccaagaaggccgtcgtattcgacgaccgctgg
gccagcgcccgcgaggacctggtgaagctgtggctgaccgacgagggcgacatcgacgcc
gactggccgcgcctggcggagcgcttcgagggtgccggccacgtcgtggcgacccaggct
acctggtggcaaggtaagtcgctggccgcgggccggcagatccatgcatcgctgtacggc
cgcatcgccgccggcgccgagaaccccgaacccggccgctacggcggcgaagttgccgtg
gtgaccggcgcttcgaagggttcgatcgccgcgtcggtggtggctcggctgctcgacggc
ggagccaccgtcatcgcgaccacctccaagctcgacgaggagcggctggcgttctaccgc
acgctgtatcgcgaccacgcccgttacggcgcggcgctgtggctggtcgcggcgaacatg
gcgtcctactccgacgtcgacgccctggtcgaatggatcggcaccgaacagaccgaaagc
cttgggccgcagtcgattcacatcaaagacgcgcagaccccgacgctgctgttcccgttc
gcggcgccacgcgtggtcggggacctgtcggaggccggttcgcgcgccgagatggagatg
aaagtgctgctgtgggccgtgcaacggctgatcggcggcctgtcgacgatcggcgccgaa
cgcgacatcgcgtcgcggctgcacgtggtgctgcccggctcgcccaaccgtggcatgttc
ggcggcgacggcgcctacggcgaagccaagtccgcgctggatgccgtggtgagccgctgg
cacgccgagtcgtcctgggcggcacgggtcagcctggcgcacgcgctcatcggctggacc
cgcggcaccgggctgatgggccacaacgatgccatcgtggccgccgtcgaagaggccggg
gtcaccacctactcgaccgacgagatggcggcgctgctgctcgacctgtgtgatgcggaa
tccaaggtggctgcggcgcgttcgccgatcaaggccgacctgaccgggggcctggccgag
gccaacctcgacatggccgagctggcggccaaggcgcgcgagcagatgtcggcagcggcg
gccgtcgacgaggacgccgaggcccctggcgccatcgccgcgctgccgtcgccgccccgg
ggtttcacccccgcaccgccgccgcaatgggacgacctcgatgtcgacccggccgacctg
gtggtgatcgtcggcggcgccgaaatcggcccgtacggctcgtcacgcacccggttcgag
atggaggtcgaaaacgagctgtcggcggccggcgtgctggagctggcctggaccactggg
ttgatccgctgggaggacgacccgcaacccggttggtacgacaccgaatccggcgaaatg
gtcgacgaatccgagttggtgcagcgctaccacgacgccgtggtgcagcgcgtcggcatt
cgcgaattcgttgatgacggcgcgatcgaccccgaccacgcctcgccgctgctggtgtcg
gtgttcctggagaaggacttcgcgttcgtggtgtcctcggaggccgatgcgcgcgccttc
gtcgagttcgatcccgagcacacggtcatccggccggtgcccgactccaccgactggcag
gtcatccgcaaggccggcaccgagatccgggtgccgcgaaagaccaagctgtcccgcgtc
gtcggcggccagatcccgaccgggttcgacccgacggtgtggggcatcagcgcagacatg
gccggttccatcgaccggttggcggtatggaacatggtggcgaccgtcgacgcgttcctg
tcgtccggtttcagcccggccgaggtgatgcgttacgtgcacccgagtttggtggccaac
acccagggcaccggcatgggcggcggcacgtcgatgcagacgatgtaccacggcaatctg
ttgggccgcaacaagccgaacgacatcttccaggaagtcttgccgaatatcattgccgcg
cacgtggttcagtcctacgtcggtagctacggtgcgatgatccacccggtagccgcgtgc
gccaccgccgcggtgtcggtcgaggaaggtgtcgacaagatccggttgggcaaggctcaa
ctggtggtggccggcggcctggatgacctgacgctggagggcatcatcggattcggtgac
atggccgccaccgccgacacgtccatgatgtgcggccgcggcatccacgactcgaagttt
tcccggcccaacgaccgccgccgtctgggcttcgtcgaagcccaaggcggcgggacgatc
ctgttggcccgcggggacctggcgctgcggatggggctgccggtgctggcggtggtggcg
ttcgcgcagtcgttcggcgacggcgtgcacacctcgatcccggccccgggcctgggcgcg
ctgggggcgggccgcggcggcaaggattcaccgctggcgcgggcgctggccaagctgggc
gtggccgccgacgacgtggcggtcatctccaagcacgacacctcgacgctggccaacgat
cccaacgagaccgagttgcatgaacggctcgccgacgccctgggccgttccgagggcgcc
ccgctgttcgtggtgtcgcagaagagcctgaccggccacgccaagggcggcgcggcggtc
ttccagatgatggggctctgccagatattgcgggatggggtgatcccacccaaccgcagc
ctcgactgcgtcgacgacgagctggccggctccgcgcatttcgtgtgggtgcgtgacacg
ttgcggctcggcggcaagttcccactcaaggccggcatgctgaccagcctcgggttcggc
catgtgtcgggcctggtcgcgttggtgcatccgcaggcgttcatcgcctcgctggatccc
gcacagcgcgcggactaccagcggcgtgccgacgcccgcctgctggccggtcagcgccgg
ctggcctcggcgattgccggtggtgcgccgatgtaccagcggcccggtgaccgtcgcttc
gaccaccacgcgcccgagcggccgcaggaggcgtcgatgctgctgaatccggcggcccgg
ctgggtgacggcgaggcgtatatcggctga

DBGET integrated database retrieval system