KEGG   Mycobacterium tuberculosis H37Rv: Rv2537cHelp
Entry
Rv2537c           CDS       T00015                                 

Gene name
aroD
Definition
(RefSeq) 3-dehydroquinate dehydratase
  KO
K03786  3-dehydroquinate dehydratase II [EC:4.2.1.10]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
mtu01230  Biosynthesis of amino acids
Module
mtu_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rv2537c (aroD)
Enzymes [BR:mtu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.10  3-dehydroquinate dehydratase
     Rv2537c (aroD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHquinase_II BtrH_N
Motif
Other DBs
NCBI-GeneID: 888397
NCBI-ProteinID: NP_217053
TubercuList: Rv2537c
UniProt: P9WPX7 I6Y9L1
Structure
PDB: 

Position
complement(2861148..2861591)
Genome map
AA seq 147 aa AA seqDB search
MSELIVNVINGPNLGRLGRREPAVYGGTTHDELVALIEREAAELGLKAVVRQSDSEAQLL
DWIHQAADAAEPVILNAGGLTHTSVALRDACAELSAPLIEVHISNVHAREEFRRHSYLSP
IATGVIVGLGIQGYLLALRYLAEHVGT
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactgatcgtgaacgtgatcaacggccccaacctgggccggttgggccggcgc
gagcccgccgtctatggcggcaccacccacgacgagctggtcgctctgatcgagcgtgag
gccgccgagctcggactcaaagccgttgtgcggcaaagtgatagcgaagcccagctgctg
gactggattcatcaggccgccgatgcggccgaacccgtgatcctcaacgccggcggtctg
acgcacacgtcggtggcactgcgcgatgcctgcgcggagctgagcgctccgctgatcgag
gtgcatatctccaacgtgcatgcgcgtgaggagttccgccgccactcctacctcagcccc
atcgcgaccggggtgatcgtcgggctcggcatccagggctacctgctggccctgcggtac
ctagctgagcatgtcgggacgtga

DBGET integrated database retrieval system