KEGG   Mycobacterium tuberculosis H37Rv: Rv2538cHelp
Entry
Rv2538c           CDS       T00015                                 

Gene name
aroB
Definition
(RefSeq) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
mtu01230  Biosynthesis of amino acids
Module
mtu_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rv2538c (aroB)
Enzymes [BR:mtu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     Rv2538c (aroB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH
Motif
Other DBs
NCBI-GeneID: 888392
NCBI-ProteinID: NP_217054
TubercuList: Rv2538c
UniProt: P9WPX9 I6Y105
Structure
PDB: 

Position
complement(2861588..2862676)
Genome map
AA seq 362 aa AA seqDB search
MTDIGAPVTVQVAVDPPYPVVIGTGLLDELEDLLADRHKVAVVHQPGLAETAEEIRKRLA
GKGVDAHRIEIPDAEAGKDLPVVGFIWEVLGRIGIGRKDALVSLGGGAATDVAGFAAATW
LRGVSIVHLPTTLLGMVDAAVGGKTGINTDAGKNLVGAFHQPLAVLVDLATLQTLPRDEM
ICGMAEVVKAGFIADPVILDLIEADPQAALDPAGDVLPELIRRAITVKAEVVAADEKESE
LREILNYGHTLGHAIERRERYRWRHGAAVSVGLVFAAELARLAGRLDDATAQRHRTILSS
LGLPVSYDPDALPQLLEIMAGDKKTRAGVLRFVVLDGLAKPGRMVGPDPGLLVTAYAGVC
AP
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatatcggcgcacccgtgaccgtgcaggtggccgtcgatccgccatacccggtg
gtcatcggtaccggcctgctcgacgagctggaagacctgctggccgaccggcacaaggtc
gccgtcgtgcatcagcccggactagccgagaccgcggaagagatccgaaagcgcttggcc
ggcaagggcgtcgacgcgcaccgcatcgagatccccgacgccgaggccggcaaggacctg
cccgtcgtgggattcatctgggaggtgttgggccgcatcggaatcggccgcaaagacgcc
ctggtcagcctcggcggcggggccgccaccgacgtcgccgggttcgcggcggccacctgg
ctgcgcggcgtctcgattgtgcacctgcccaccacactgctgggcatggtcgatgcggcc
gtcggcggcaagaccggcatcaacaccgacgccggcaagaacctggtcggggcgtttcat
cagccgttggcggtcctggtggacctggcgacgctgcaaaccttgccacgcgacgaaatg
atctgcggcatggccgaagtggtcaaggccggcttcatcgccgacccggtgatcctggat
ctcatcgaagctgacccgcaggccgcactcgacccggccggcgacgtgctgcccgagctg
atccggcgcgcgatcaccgtcaaggccgaggtggtcgccgccgacgaaaaggaatccgag
ctgcgcgaaatcctcaactacggccacacattaggccacgcgatcgagcgccgggaacgc
taccggtggcgccacggcgccgccgtgtcggtggggctggtgttcgcggccgagctggcc
aggcttgccgggcggctcgacgacgcgaccgcgcagcgccaccgcaccatcctgtcctcg
ttgggattgccggtcagctacgacccggacgcgctgccccagctgctggaaatcatggcc
ggcgacaagaagactcgggcgggtgtgttgcggttcgtggtgctcgacggattggccaag
ccgggccgaatggtgggaccggaccccggtctgctggtaaccgcctacgccggagtttgc
gccccatga

DBGET integrated database retrieval system