KEGG   Mycobacterium tuberculosis H37Rv: Rv2539cHelp
Entry
Rv2539c           CDS       T00015                                 

Gene name
aroK
Definition
(RefSeq) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
mtu01230  Biosynthesis of amino acids
Module
mtu_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rv2539c (aroK)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     Rv2539c (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 AAA_17 AAA_5 Mg_chelatase Cytidylate_kin KTI12 AAA AAA_22 ParA 6PF2K MMR_HSR1 Gly_kinase CoaE AAA_28 AAA_16 AAA_24
Motif
Other DBs
NCBI-GeneID: 887434
NCBI-ProteinID: NP_217055
TubercuList: Rv2539c
UniProt: P9WPY3 I6XEJ5
Structure
PDB: 

Position
complement(2862673..2863203)
Genome map
AA seq 176 aa AA seqDB search
MAPKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRI
EEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLL
AGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQVPSPSEAAT
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atggcacccaaagcggttctcgtcggcctgccgggctccggcaagtccaccatcgggcgc
cggctggccaaggcgctcggggtcggcctgctcgacaccgacgtcgcgatcgagcagcgg
accggacgcagcatcgccgacatcttcgccaccgacggggagcaggagttccgacgtatc
gaggaggacgtggtgcgcgcggcactggccgaccacgacggtgtgctgtcgctcggcggc
ggcgcggtgaccagccccggtgtgcgcgcggcgctggccggccacaccgtcgtctacctg
gagatcagcgccgccgagggcgtgcgccgcaccggcggcaacaccgtgcgcccactgctg
gccggccccgaccgcgccgaaaaataccgcgcgctgatggccaagcgggcaccgctgtac
cggcgcgtcgcgaccatgcgagtggacaccaatcgccgcaaccccggggcggtggtccgc
catatcctgtcgcggctgcaggttcccagccccagcgaggcggccacatga

DBGET integrated database retrieval system