KEGG   Mycobacterium tuberculosis H37Rv: Rv2552cHelp
Entry
Rv2552c           CDS       T00015                                 

Gene name
aroE
Definition
(RefSeq) shikimate 5-dehydrogenase
  KO
K00014  shikimate dehydrogenase [EC:1.1.1.25]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
mtu01230  Biosynthesis of amino acids
Module
mtu_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rv2552c (aroE)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.25  shikimate dehydrogenase
     Rv2552c (aroE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Shikimate_dh_N Shikimate_DH F420_oxidored
Motif
Other DBs
NCBI-GeneID: 887330
NCBI-ProteinID: NP_217068
TubercuList: Rv2552c
UniProt: I6Y120
Structure
PDB: 

Position
complement(2871206..2872015)
Genome map
AA seq 269 aa AA seqDB search
MSEGPKKAGVLGSPIAHSRSPQLHLAAYRALGLHDWTYERIECGAAELPVVVGGFGPEWV
GVSVTMPGKFAALRFADERTARADLVGSANTLVRTPHGWRADNTDIDGVAGALGAAAGHA
LVLGSGGTAPAAVVGLAELGVTDITVVARNSDKAARLVDLGTRVGVATRFCAFDSGGLAD
AVAAAEVLVSTIPAEVAAGYAGTLAAIPVLLDAIYDPWPTPLAAAVGSAGGRVISGLQML
LHQAFAQVEQFTGLPAPREAMTCALAALD
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaggtcccaaaaaagccggcgtgcttggttcgccgatcgcgcattcccgctcc
ccgcagctgcacctggccgcctaccgggcgttggggctgcacgactggacctatgagcgc
atcgaatgcggtgcggccgagttgcccgtcgtggtcggtggtttcggaccggagtgggtc
ggtgtttcggtgaccatgccgggcaagttcgccgccctgcggttcgccgacgagcgcacc
gcacgcgcggaccttgtcggttcggccaacaccctggttcggacgccgcatggctggcgg
gccgacaacaccgacatcgacggggtggccggggcgttgggggcggctgctggacacgcg
ctggtgctggggtccggggggaccgcaccggcggccgtggtggggctggccgaactcggg
gtcaccgacatcaccgtggtggcgcgcaactcggacaaggcggcccggctggtggacctg
ggcacacgggtcggcgtggcgacccggttctgcgcgttcgacagcggtgggttggccgat
gcggtggccgccgcggaagtgctggtcagcaccattccagcggaggtggccgcggggtat
gccggcaccttggccgcgatcccggtgctgttggacgccatctacgatccgtggcccaca
ccgctggccgccgcggtcggatcggcgggcgggcgggtgatcagcgggctgcagatgttg
ctgcatcaggcgttcgcgcaggtggagcagttcaccgggctacccgccccccgcgaagcg
atgacttgcgcgctggccgcgttggactag

DBGET integrated database retrieval system