KEGG   Mycobacterium tuberculosis H37Rv: Rv2583cHelp
Entry
Rv2583c           CDS       T00015                                 

Gene name
relA
Definition
(RefSeq) bifunctional (p)ppGpp synthase/hydrolase RelA
  KO
K00951  GTP pyrophosphokinase [EC:2.7.6.5]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Rv2583c (relA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.5  GTP diphosphokinase
     Rv2583c (relA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD_4 RelA_SpoT TGS ACT_4 HD ACT Ub-Mut7C
Motif
Other DBs
NCBI-GeneID: 887888
NCBI-ProteinID: NP_217099
TubercuList: Rv2583c
UniProt: P9WHG9 I6Y150
Structure
PDB: 

Position
complement(2907826..2910198)
Genome map
AA seq 790 aa AA seqDB search
MAEDQLTAQAVAPPTEASAALEPALETPESPVETLKTSISASRRVRARLARRMTAQRSTT
NPVLEPLVAVHREIYPKADLSILQRAYEVADQRHASQLRQSGDPYITHPLAVANILAELG
MDTTTLVAALLHDTVEDTGYTLEALTEEFGEEVGHLVDGVTKLDRVVLGSAAEGETIRKM
ITAMARDPRVLVIKVADRLHNMRTMRFLPPEKQARKARETLEVIAPLAHRLGMASVKWEL
EDLSFAILHPKKYEEIVRLVAGRAPSRDTYLAKVRAEIVNTLTASKIKATVEGRPKHYWS
IYQKMIVKGRDFDDIHDLVGVRILCDEIRDCYAAVGVVHSLWQPMAGRFKDYIAQPRYGV
YQSLHTTVVGPEGKPLEVQIRTRDMHRTAEYGIAAHWRYKEAKGRNGVLHPHAAAEIDDM
AWMRQLLDWQREAADPGEFLESLRYDLAVQEIFVFTPKGDVITLPTGSTPVDFAYAVHTE
VGHRCIGARVNGRLVALERKLENGEVVEVFTSKAPNAGPSRDWQQFVVSPRAKTKIRQWF
AKERREEALETGKDAMAREVRRGGLPLQRLVNGESMAAVARELHYADVSALYTAIGEGHV
SAKHVVQRLLAELGGIDQAEEELAERSTPATMPRRPRSTDDVGVSVPGAPGVLTKLAKCC
TPVPGDVIMGFVTRGGGVSVHRTDCTNAASLQQQAERIIEVLWAPSPSSVFLVAIQVEAL
DRHRLLSDVTRALADEKVNILSASVTTSGDRVAISRFTFEMGDPKHLGHLLNAVRNVEGV
YDVYRVTSAA
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
gtggccgaggaccagctcacggcgcaagcggttgcaccgcccacggaggcttctgcggct
ctcgagcccgctctcgagacgcccgagtcgccggtcgagactcttaagaccagcatcagc
gcgtcgcgtcgggtgcgggcccgattggcccggcggatgaccgcccagcgcagcaccacc
aatccggtgctcgagccgttggtggcggtgcaccgggagatctatcccaaggccgacctg
tcgatcttgcagcgagcctacgaggtcgctgaccaaaggcatgccagccagttgcggcag
tccggtgatccctacatcacccacccgttggccgttgccaacattctggccgagttgggc
atggacaccaccactttggtggccgcgctgctgcacgacaccgtcgaggacaccggttac
accctggaggcgttgaccgaggaattcggcgaagaggtgggccatctcgtcgacggggtg
accaagctggatcgggtggtgttgggcagcgccgccgaaggcgagactattcgcaagatg
atcaccgcgatggcccgcgatccgcgggtgctggtgataaaggtggctgaccggttacac
aacatgcgcaccatgcgcttcttgccgccggagaagcaggcccgcaaggcccgtgagacg
ttggaagtcattgcacccctggcgcatcggctgggcatggccagcgtcaagtgggagttg
gaggacctgtccttcgcgatcctgcatcccaagaagtacgaggagatcgtccggctggtc
gccggtcgcgcgccgtcccgggacacctacctggccaaggtgcgtgccgaaatcgtcaac
acgctgaccgcgtcgaagatcaaggcgacggtggagggccgccccaagcactattggtcg
atctaccagaagatgatcgttaagggccgcgacttcgacgacatccacgacctggtcggt
gtgcgcatcctgtgcgacgaaatccgggactgctacgcggctgtcggcgtagtgcattcg
ctatggcagccgatggcgggtcggttcaaggactacatcgcccagcccagatacggtgtg
taccagtcactgcacaccactgtggtcgggcctgagggcaagccgctggaagtgcagatc
cgtacccgcgacatgcaccgcaccgccgaatacggcatcgccgcgcattggcgctacaaa
gaagccaagggccgcaacggtgttcttcatccgcatgccgccgcggagatcgacgacatg
gcctggatgcgtcagctgctcgactggcaacgtgaggcggccgaccccggtgagttcttg
gaatcattgcgctacgaccttgcggtgcaagagattttcgtgtttacccccaagggcgac
gtgatcacgctgccaaccggttcgacgccggtggacttcgcttacgcggtgcacacagag
gtgggccaccgctgcatcggcgcccgagtgaacggccggttggtagcgctggaacgcaag
ctggaaaacggagaagttgtcgaggttttcacgtccaaggcgccgaacgccgggccgtcg
cgggactggcagcagttcgtggtgtcgccgcgcgcaaagacgaagatccgccagtggttc
gccaaggagcggcgtgaggaggcgttggagaccggtaaggatgcgatggcccgcgaggtg
cgccgcggtggacttccgttgcagcgcttggtcaatggtgagtccatggcggcggtggcc
cgcgagctgcactacgcggacgtgtcagcactctataccgccatcggtgaggggcacgtg
tcggcgaaacacgtcgtgcagcggttgttggccgagctcggcggtatcgaccaggcggaa
gaggaactcgccgagcggtccacgccggcgaccatgccgcggcgcccacgcagcaccgac
gatgtcggggtctccgtccccggcgccccgggcgtgctgaccaagctggccaagtgctgc
acgccggttccgggcgatgtgattatggggttcgtcacccgtggcggcggggtcagtgtg
caccgcaccgactgcaccaacgccgcatcgctgcagcagcaggccgagcgcatcatcgag
gtgctatgggcgccgtcgccgtcgtcggtgtttctggtggcaatccaggtcgaggcactc
gaccggcaccggctgctgtcggatgtgacgcgcgcactggccgacgagaaggtcaatatc
ctgtccgcgtcggtcaccacttcgggggaccgggtggcgatcagtcgattcaccttcgag
atgggtgaccccaagcacctcgggcacctgctcaacgccgtccgcaacgtcgaaggtgtc
tacgacgtctaccgggtgacctcggccgcgtag

DBGET integrated database retrieval system