KEGG   Mycobacterium tuberculosis H37Rv: Rv2584cHelp
Entry
Rv2584c           CDS       T00015                                 

Gene name
apt
Definition
(RefSeq) adenine phosphoribosyltransferase
  KO
K00759  adenine phosphoribosyltransferase [EC:2.4.2.7]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00230  Purine metabolism
mtu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Rv2584c (apt)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtu04147]
    Rv2584c (apt)
Enzymes [BR:mtu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.7  adenine phosphoribosyltransferase
     Rv2584c (apt)
Exosome [BR:mtu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rv2584c (apt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran DUF4938 UPRTase
Motif
Other DBs
NCBI-GeneID: 888579
NCBI-ProteinID: NP_217100
TubercuList: Rv2584c
UniProt: P9WQ07
Position
complement(2910229..2910900)
Genome map
AA seq 223 aa AA seqDB search
MCHGGTWAGDYVLNVIATGLSLKARGKRRRQRWVDDGRVLALGESRRSSAISVADVVASL
TRDVADFPVPGVEFKDLTPLFADRRGLAAVTEALADRASGADLVAGVDARGFLVAAAVAT
RLEVGVLAVRKGGKLPRPVLSEEYYRAYGAATLEILAEGIEVAGRRVVIIDDVLATGGTI
GATRRLLERGGANVAGAAVVVELAGLSGRAALAPLPVHSLSRL
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtgtgccatggcggtacatgggctggtgactacgtgttgaacgtgatcgcgacggggctc
tccttaaaggcacgggggaagcgccgccggcagcgttgggtcgacgacgggcgggtattg
gcgctcggtgagtcccgccggagctcagccatatctgtggccgacgtggttgcgtcgctg
acccgggatgtggccgactttccggttcccggcgtcgagttcaaggacctcaccccgcta
ttcgccgaccgaagaggattggccgcggtaaccgaagcgctggccgatcgggcgtccgga
gctgacctggtggccggcgtcgacgcccgcgggtttctggtggcagccgcggtcgccacc
cggctcgaagtgggtgtgctggccgttcgcaagggcggcaagctgccccggccggtgctc
agcgaggagtactacagggcgtacggcgccgccactctggagattctcgctgagggcatc
gaggttgcgggccgccgtgtcgtgatcattgacgacgtgttagcaaccggcggcaccatc
ggcgcgacgcgacgcctgcttgagcgcggtggcgccaacgtggccggggcggccgtagtg
gtggaacttgcggggttgagcggtcgcgcggcgctcgcaccgctgccggtgcacagcctg
agccgcctgtga

DBGET integrated database retrieval system