KEGG   Mycobacterium tuberculosis H37Rv: Rv2612cHelp
Entry
Rv2612c           CDS       T00015                                 

Gene name
pgsA1
Definition
(RefSeq) CDP-diacylglycerol--inositol 3-phosphatidyltransferase
  KO
K00995  CDP-diacylglycerol---glycerol-3-phosphate 3-phosphatidyltransferase [EC:2.7.8.5]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00564  Glycerophospholipid metabolism
mtu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Rv2612c (pgsA1)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.5  CDP-diacylglycerol---glycerol-3-phosphate 1-phosphatidyltransferase
     Rv2612c (pgsA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDP-OH_P_transf DUF4229
Motif
Other DBs
NCBI-GeneID: 888209
NCBI-ProteinID: YP_177894
TubercuList: Rv2612c
UniProt: P9WPG7 I6Y178
Position
complement(2939959..2940612)
Genome map
AA seq 217 aa AA seqDB search
MSKLPFLSRAAFARITTPIARGLLRVGLTPDVVTILGTTASVAGALTLFPMGKLFAGACV
VWFFVLFDMLDGAMARERGGGTRFGAVLDATCDRISDGAVFCGLLWWIAFHMRDRPLVIA
TLICLVTSQVISYIKARAEASGLRGDGGFIERPERLIIVLTGAGVSDFPFVPWPPALSVG
MWLLAVASVITCVQRLHTVWTSPGAIDRMAIPGKGDR
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagctgcccttcctgtcccgggcggcgttcgcccggattaccaccccgatcgcc
aggggactgctgcgggtcggcctcacgccggacgtcgtcaccatcctgggcaccaccgcg
tcggtggcgggagcgctgacgctgttcccgatgggcaagctgttcgcgggtgcgtgtgtg
gtgtggttcttcgtgttgttcgacatgctggacggggcgatggcccgggagcgcgggggc
ggcactcgcttcggcgcggtgctggacgccacctgtgaccgcatcagtgacggcgcggtg
ttctgcggtctgctgtggtggatagcgtttcacatgcgcgaccgaccgctggtgatcgcg
accttgatctgtctggtcacctcgcaggtgatctcttacatcaaggcccgggcggaggcc
agcgggctgcgcggcgacggcggcttcatcgaacggccggaacggttgatcatcgtgctg
accggcgccggggtgtcggacttcccgtttgtgccctggccgccggcgttgtcggtgggg
atgtggctgctggccgtcgccagcgtgatcacctgcgtgcagcggttgcacacggtctgg
acttcacccggagccatcgatcggatggcgattcctggaaagggcgaccggtga

DBGET integrated database retrieval system