KEGG   Mycobacterium tuberculosis H37Rv: Rv2697cHelp
Entry
Rv2697c           CDS       T00015                                 

Gene name
dut
Definition
(RefSeq) deoxyuridine 5'-triphosphate nucleotidohydrolase
  KO
K01520  dUTP pyrophosphatase [EC:3.6.1.23]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00240  Pyrimidine metabolism
mtu00983  Drug metabolism - other enzymes
mtu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rv2697c (dut)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    Rv2697c (dut)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mtu03400]
    Rv2697c (dut)
Enzymes [BR:mtu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.23  dUTP diphosphatase
     Rv2697c (dut)
DNA repair and recombination proteins [BR:mtu03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    Rv2697c (dut)
 Prokaryotic Type
    Rv2697c (dut)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dUTPase
Motif
Other DBs
NCBI-GeneID: 887290
NCBI-ProteinID: NP_217213
TubercuList: Rv2697c
UniProt: P9WNS5 I6YE58
Structure
PDB: 

Position
complement(3013683..3014147)
Genome map
AA seq 154 aa AA seqDB search
MSTTLAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGL
VHPRSGLATRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIAQLLVQRVE
LVELVEVSSFDEAGLASTSRGDGGHGSSGGHASL
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgaccactctggcgatcgtccgcctcgaccccgggctcccgctgcccagccgcgct
cacgacggcgacgccggcgttgatctctacagcgccgaagacgtcgagctggcacctggg
cgccgcgccctggtacggacgggtgttgcggtcgccgtcccgttcggcatggtcgggctg
gtccatccgcgctccgggttggccacgcgggtggggctttcgatcgtcaacagtccgggc
accatcgacgcgggttatcgtggggagatcaaggtggccctgatcaacttggacccagcc
gcgcccatcgtggtacatcgcggtgaccgaatcgcccagttgctagtgcaacgggttgag
ttggtcgagctggtcgaggtctcgtcgttcgacgaggccgggctggcctcgacatcccgc
ggcgacggtggccacggttcctccggcggacatgcgagtttgtga

DBGET integrated database retrieval system