KEGG   Mycobacterium tuberculosis H37Rv: Rv2701cHelp
Entry
Rv2701c           CDS       T00015                                 

Gene name
suhB
Definition
(RefSeq) inositol-1-monophosphatase SuhB
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00521  Streptomycin biosynthesis
mtu00562  Inositol phosphate metabolism
mtu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Rv2701c (suhB)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rv2701c (suhB)
Enzymes [BR:mtu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     Rv2701c (suhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-GeneID: 887210
NCBI-ProteinID: NP_217217
TubercuList: Rv2701c
UniProt: P9WKI9 I6XF35
Structure
PDB: 

Position
complement(3015863..3016735)
Genome map
AA seq 290 aa AA seqDB search
MTRPDNEPARLRSVAENLAAEAAAFVRGRRAEVFGISRAGDGDGAVRAKSSPTDPVTVVD
TDTERLLRDRLAQLRPGDPILGEEGGGPADVTATPSDRVTWVLDPIDGTVNFVYGIPAYA
VSIGAQVGGITVAGAVADVAARTVYSAATGLGAHLTDERGRHVLRCTGVDELSMALLGTG
FGYSVRCREKQAELLAHVVPLVRDVRRIGSAALDLCMVAAGRLDAYYEHGVQVWDCAAGA
LIAAEAGARVLLSTPRAGGAGLVVVAAAPGIADELLAALQRFNGLEPIPD
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgacacgacctgacaacgaacccgcgcggctgcgctctgtggccgaaaaccttgctgcc
gaggcggcggccttcgttcgcggtcgtcgggccgaggttttcggcatctccagggcgggc
gacggcgacggcgcggtgcgcgcgaagagcagcccgaccgatccggtgaccgtggtcgac
accgacacggagcggctcttgcgtgatcggttggctcaacttcggcccggtgacccgatt
ctcggggaggaaggtggtggtcccgccgacgtgacggctacaccctccgaccgggtcact
tgggtgctcgaccccatcgacggcacggtgaatttcgtctacggcatcccggcgtacgcg
gtgtcgattggggcacaggttggcggcatcacggtggcgggcgcggtcgccgacgtcgcc
gctcgcacggtgtattcggcggcgacgggcctcggcgcacatctcaccgatgagcggggg
agacatgtgttgcggtgcaccggtgtcgacgagttgtcgatggcgttgctgggtaccggc
ttcgggtactcggttcggtgccgcgagaagcaggcagaattgctggctcatgttgtgccg
ttggtccgcgacgtgcgtcggatcggttctgcggcgctggacttgtgcatggtagcggcg
ggtcggctggacgcctactacgagcacggggtgcaggtgtgggactgtgcggcaggtgcg
ttgatcgccgctgaggcgggggcccgcgtgttgttgtcaacgccgagagcgggcggcgcg
gggttggtggtggtggctgccgcgcccggaatcgccgacgagctgttggcggcgctacag
cgattcaacggcctagagccgatcccggactga

DBGET integrated database retrieval system