KEGG   Mycobacterium tuberculosis H37Rv: Rv2702Help
Entry
Rv2702            CDS       T00015                                 

Gene name
ppgK
Definition
(RefSeq) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00010  Glycolysis / Gluconeogenesis
mtu00520  Amino sugar and nucleotide sugar metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
Module
mtu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mtu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rv2702 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    Rv2702 (ppgK)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Rv2702 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-GeneID: 887313
NCBI-ProteinID: NP_217218
TubercuList: Rv2702
UniProt: P9WIN1 I6YE62
Position
3016858..3017655
Genome map
AA seq 265 aa AA seqDB search
MTSTGPETSETPGATTQRHGFGIDVGGSGIKGGIVDLDTGQLIGDRIKLLTPQPATPLAV
AKTIAEVVNGFGWRGPLGVTYPGVVTHGVVRTAANVDKSWIGTNARDTIGAELGGQQVTI
LNDADAAGLAETRYGAGKNNPGLVVLLTFGTGIGSAVIHNGTLIPNTEFGHLEVGGKEAE
ERAASSVKEKNDWTYPKWAKQVIRVLIAIENAIWPDLFIAGGGISRKADKWVPLLENRTP
VVPAALQNTAGIVGAAMASVADTTH
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcaccggccccgagacgtccgaaacaccgggtgccacgacacagcgtcatggc
ttcggcatcgacgtcggcggcagcggcatcaagggcggaatcgtcgacttggacaccggc
cagctgatcggcgaccggatcaagctgctgaccccgcaaccggccactccgttggcggtc
gccaaaaccatcgccgaggtcgtcaacggtttcggctggcggggtccgctgggggtgacc
tatcccggcgtcgtcactcacggcgtcgtccggaccgcggctaacgtggacaagtcctgg
atagggaccaacgcacgcgacactatcggcgccgagctgggcggtcagcaggtcaccatc
ctcaacgacgctgatgccgccgggctggccgagacacgctacggggccggcaagaacaac
cctggcttagtggtactgctcacattcggaaccgggatcgggtccgcggtcatccacaac
gggacgttgatacccaacaccgagttcggacatcttgaggtcggcggcaaggaagcggag
gaaagggccgcctcctcggtaaaggaaaagaacgactggacctatccaaagtgggccaag
caggtgatacgcgtgctcatcgccatcgagaacgcgatctggcctgacctgttcatcgcc
ggcggcggcatcagccgcaaggccgacaaatgggtgccgctactggaaaaccgcacacca
gtagtgcccgcggccctgcagaacaccgccggaattgtcggtgcggccatggcctctgtc
gcagatacgacgcactga

DBGET integrated database retrieval system