KEGG   Mycobacterium tuberculosis H37Rv: Rv2713Help
Entry
Rv2713            CDS       T00015                                 

Gene name
sthA
Definition
(RefSeq) pyridine nucleotide transhydrogenase
  KO
K00322  NAD(P) transhydrogenase [EC:1.6.1.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00760  Nicotinate and nicotinamide metabolism
mtu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Rv2713 (sthA)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.1  With NAD+ or NADP+ as acceptor
    1.6.1.1  NAD(P)+ transhydrogenase (Si-specific)
     Rv2713 (sthA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_oxidored GIDA AlaDh_PNT_C NAD_binding_8 HI0933_like DAO FAD_binding_2 FAD_binding_3 Thi4 3HCDH_N XdhC_C K_oxygenase ThiF 2-Hacid_dh_C TrkA_N UDPG_MGDP_dh_N NAD_binding_7
Motif
Other DBs
NCBI-GeneID: 887355
NCBI-ProteinID: NP_217229
TubercuList: Rv2713
UniProt: P9WHH5
Position
3025441..3026847
Genome map
AA seq 468 aa AA seqDB search
MREYDIVVIGSGPGGQKAAIASAKLGKSVAIVERGRMLGGVCVNTGTIPSKTLREAVLYL
TGMNQRELYGASYRVKDRITPADLLARTQHVIGKEVDVVRNQLMRNRVDLIVGHGRFIDP
HTILVEDQARREKTTVTGDYIIIATGTRPARPSGVEFDEERVLDSDGILDLKSLPSSMVV
VGAGVIGIEYASMFAALGTKVTVVEKRDNMLDFCDPEVVEALKFHLRDLAVTFRFGEEVT
AVDVGSAGTVTTLASGKQIPAETVMYSAGRQGQTDHLDLHNAGLEVQGRGRIFVDDRFQT
KVDHIYAVGDVIGFPALAATSMEQGRLAAYHAFGEPTDGITELQPIGIYSIPEVSYVGAT
EVELTKSSIPYEVGVARYRELARGQIAGDSYGMLKLLVSTEDLKLLGVHIFGTSATEMVH
IGQAVMGCGGSVEYLVDAVFNYPTFSEAYKNAALDVMNKMRALNQFRR
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaatacgacatcgtggtgatcgggtcaggcccgggcggacagaaagccgccatc
gcctcggcgaagctgggcaagtccgtggccatcgtcgaacgcggccgaatgctcggcggc
gtctgcgtcaacacaggcacgatcccatccaaaacgttgcgtgaggctgtgctctacctc
accggcatgaaccaacgcgagctgtacggcgcaagctaccgcgtgaaggaccggatcacc
ccggccgacctgttggcgcggacccagcacgtgatcggcaaggaagtcgacgtggtgcgc
aaccagctgatgcgtaaccgcgtcgatctgatcgtgggccatggccggttcatcgacccg
cacaccatcctcgtggaggaccaggcccgcagggaaaagaccaccgtcaccggcgactac
atcatcatcgccactggcaccaggccggcacggccatccggagtcgaatttgacgaagaa
cgggtgctcgactccgacgggatcctcgatctcaaatcgctgccatcctcgatggtcgtg
gtcggtgccggcgtgatcggcatcgaatacgcctccatgttcgctgcgttgggcaccaaa
gtcaccgtcgtggagaagcgggacaacatgctggacttctgcgaccccgaggtcgtcgag
gcgctgaaattccacctgcgcgacctggcggtgacattccggttcggcgaggaagtgacc
gcggtcgatgtcggctctgcgggcaccgtgaccaccctggccagcggcaaacagattcca
gccgagaccgtaatgtactcggcgggacgtcagggacaaaccgaccacctcgacctgcac
aacgccggactcgaggtgcagggccgcgggcggatcttcgtagacgaccgtttccagacc
aaggtagaccacatctacgccgtcggcgacgtcattggcttccccgccttggccgcgacg
tcgatggagcaggggcggctggccgcctaccacgccttcggcgaaccaaccgacggaatc
accgaacttcagccgatcggtatttattcgattcccgaggtgtcctacgtcggcgccacc
gaggtggaactgaccaagagctccatcccatacgaggtgggagtggcccgctaccgggag
ctggcccgcggccaaatcgccggcgactcctacggcatgctcaagctgctggtttccacc
gaggatctcaagctgctcggcgtgcatatcttcggcaccagcgccaccgagatggtgcac
atcgggcaggccgtgatgggatgcgggggcagcgtcgagtacctggtcgacgcggtgttc
aactacccgaccttctcggaggcctacaagaacgccgcactggacgtgatgaacaagatg
cgcgcactcaaccagttccgccgctga

DBGET integrated database retrieval system