KEGG   Mycobacterium tuberculosis H37Rv: Rv2726cHelp
Entry
Rv2726c           CDS       T00015                                 

Gene name
dapF
Definition
(RefSeq) diaminopimelate epimerase
  KO
K01778  diaminopimelate epimerase [EC:5.1.1.7]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00300  Lysine biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01230  Biosynthesis of amino acids
Module
mtu_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Rv2726c (dapF)
Enzymes [BR:mtu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.7  diaminopimelate epimerase
     Rv2726c (dapF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAP_epimerase
Motif
Other DBs
NCBI-GeneID: 888614
NCBI-ProteinID: NP_217242
TubercuList: Rv2726c
UniProt: P9WP19 I6XF56
Structure
PDB: 

Position
complement(3038931..3039800)
Genome map
AA seq 289 aa AA seqDB search
MIFAKGHGTQNDFVLLPDVDAELVLTAARVAALCDRRKGLGADGVLRVTTAGAAQAVGVL
DSLPEGVRVTDWYMDYRNADGSAAQMCGNGVRVFAHYLRASGLEVRDEFVVGSLAGPRPV
TCHHVEAAYADVSVDMGKANRLGAGEAVVGGRRFHGLAVDVGNPHLACVDSQLTVDGLAA
LDVGAPVSFDGAQFPDGVNVEVLTAPVDGAVWMRVHERGVGETRSCGTGTVAAAVAALAA
VGSPTGTLTVHVPGGEVVVTVTDATSFLRGPSVLVARGDLADDWWNAMG
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgatcttcgcgaagggccacggtacccagaacgacttcgtgttgctgcctgacgtcgac
gccgagttggtgctcaccgctgcccgggtggcggcattgtgcgaccggcggaaggggctg
ggcgccgacggggtgttgcgggttacgaccgccggagccgcccaggcggtaggagtgctg
gacagcctgcccgagggtgtccgcgtgaccgactggtacatggattaccgcaacgccgac
gggtcggcagcccagatgtgcggcaacggtgtgcgagtgttcgcgcactacttgcgtgcc
agtggcctggaggttcgcgacgagttcgtcgtagggtcactggccggaccgcgaccagtc
acctgccaccacgtcgaggcggcctacgccgacgtctccgtcgacatgggcaaggccaac
agattgggcgcaggggaggctgttgttggtggcaggcggtttcacggcctggccgtcgat
gtgggtaacccgcatctggcgtgcgtggattcccagctgaccgtcgacggcctggcggca
ttggacgtgggtgcgccggtgagtttcgatggtgcgcagttccccgacggggtcaatgtc
gaggtactcaccgcgccggtcgacggggcggtctggatgcgggttcacgaacgcggcgtg
ggggaaacccgctcgtgtggcaccgggacggttgcggccgcggtcgccgcgttggcggcg
gtgggctcgccgaccggaacgctcaccgtgcacgtgccgggcggagaggtcgtggttacc
gtcaccgatgccaccagcttcctgcgtgggccgtcagtgttggtggcccgcggagatctc
gctgacgattggtggaacgcgatggggtga

DBGET integrated database retrieval system