KEGG   Mycobacterium tuberculosis H37Rv: Rv2753cHelp
Entry
Rv2753c           CDS       T00015                                 

Gene name
dapA
Definition
(RefSeq) 4-hydroxy-tetrahydrodipicolinate synthase
  KO
K01714  4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00261  Monobactam biosynthesis
mtu00300  Lysine biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01230  Biosynthesis of amino acids
Module
mtu_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Rv2753c (dapA)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    Rv2753c (dapA)
Enzymes [BR:mtu01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.7  4-hydroxy-tetrahydrodipicolinate synthase
     Rv2753c (dapA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHDPS Peripla_BP_6 FMN_dh
Motif
Other DBs
NCBI-GeneID: 888289
NCBI-ProteinID: NP_217269
TubercuList: Rv2753c
UniProt: P9WP25 I6YA59
Structure
PDB: 

Position
complement(3066222..3067124)
Genome map
AA seq 300 aa AA seqDB search
MTTVGFDVAARLGTLLTAMVTPFSGDGSLDTATAARLANHLVDQGCDGLVVSGTTGESPT
TTDGEKIELLRAVLEAVGDRARVIAGAGTYDTAHSIRLAKACAAEGAHGLLVVTPYYSKP
PQRGLQAHFTAVADATELPMLLYDIPGRSAVPIEPDTIRALASHPNIVGVKDAKADLHSG
AQIMADTGLAYYSGDDALNLPWLAMGATGFISVIAHLAAGQLRELLSAFGSGDIATARKI
NIAVAPLCNAMSRLGGVTLSKAGLRLQGIDVGDPRLPQVAATPEQIDALAADMRAASVLR
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccgtcggattcgacgtcgcagcgcgcctaggaaccctgctgaccgcgatggtg
acaccgtttagcggcgatggctccctggacaccgccaccgcggcgcggctggccaaccac
ctggtcgatcaggggtgcgacggtctggtggtctcgggcaccaccggcgagtcgccgacc
accaccgacggggagaaaatcgagctgctgcgggccgtcttggaagcggtgggggaccgg
gcccgtgttatcgccggtgccggcacctatgacaccgcgcacagcatccggctggccaag
gcttgtgcggccgagggtgcgcacgggctgctggtggtcacgccctactattccaagccg
ccgcagcgggggctgcaagcccatttcaccgccgtcgccgacgcgaccgagctgccgatg
ctgctctatgacatcccggggcggtcggcggtgccgatcgagcccgacacgatccgcgcg
ttggcgtcgcatccgaacatcgtcggagtcaaggacgccaaagccgacctgcacagcggc
gcccaaatcatggccgacaccggactggcctactattccggcgacgacgcgctcaacctg
ccctggctggccatgggcgccacgggcttcatcagcgtgattgcccacctggcagccggg
cagcttcgagagttgttgtccgccttcggttctggggatatcgccaccgcccgcaagatc
aacattgcggtcgccccgctgtgcaacgcgatgagccgcctgggtggggtgacgttgtcc
aaggcgggcttgcggctgcagggcatcgacgtcggtgatccccggctgccccaggtggcc
gcgacaccggagcagatcgacgcgttggccgccgacatgcgcgcggcctcggtgcttcgg
tga

DBGET integrated database retrieval system