KEGG   Mycobacterium tuberculosis H37Rv: Rv2773cHelp
Entry
Rv2773c           CDS       T00015                                 

Gene name
dapB
Definition
(RefSeq) 4-hydroxy-tetrahydrodipicolinate reductase
  KO
K00215  4-hydroxy-tetrahydrodipicolinate reductase [EC:1.17.1.8]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00261  Monobactam biosynthesis
mtu00300  Lysine biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01230  Biosynthesis of amino acids
Module
mtu_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Rv2773c (dapB)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    Rv2773c (dapB)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.8  4-hydroxy-tetrahydrodipicolinate reductase
     Rv2773c (dapB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DapB_C DapB_N Semialdhyde_dh
Motif
Other DBs
NCBI-GeneID: 888443
NCBI-ProteinID: NP_217289
TubercuList: Rv2773c
UniProt: P9WP23 I6Y1N9
Structure
PDB: 

Position
complement(3081604..3082341)
Genome map
AA seq 245 aa AA seqDB search
MRVGVLGAKGKVGATMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEVVIDFTHPDVVMG
NLEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFAIGAVLSMHFAKQAA
RFFDSAEVIELHHPHKADAPSGTAARTAKLIAEARKGLPPNPDATSTSLPGARGADVDGI
PVHAVRLAGLVAHQEVLFGTEGETLTIRHDSLDRTSFVPGVLLAVRRIAERPGLTVGLEP
LLDLH
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtaggcgtccttggagccaaaggcaaggtcggagcgacgatggtgcgggcggtg
gcggccgccgacgacctgaccctatccgccgagctggatgccggcgatccgctgagcctg
ctaacggacggtaacaccgaggtcgtcatcgacttcacccacccggacgtggtgatgggc
aatctggagttcctcatcgacaacggaattcacgccgtggtcggtaccacggggttcacc
gccgagcggtttcaacaagtcgaatcgtggctcgtcgcaaaacccaacacatcggtgttg
atagcgccaaacttcgcgatcggagcggtgctgtccatgcatttcgccaagcaggccgca
cggtttttcgactcggccgaggtcattgagctgcatcatccgcacaaggctgacgcgccg
tcaggcacggccgcgcgtaccgcgaagctgatcgccgaggcccgaaaaggcttgccgccc
aatcccgatgccaccagtaccagcctgccgggcgcgcgtggtgccgacgtcgacggcata
ccggtgcacgcggtgcggctggccggactggtcgcccaccaggaggtgctgttcgggacc
gagggggagactctgaccatccgccacgatagcctcgatcgcacatcgtttgtgcccggt
gtgctgttggcggtgcgccgcatcgccgaacgccctggtctcaccgtaggtcttgagccc
ctactcgatctgcactga

DBGET integrated database retrieval system