KEGG   Mycobacterium tuberculosis H37Rv: Rv2780Help
Entry
Rv2780            CDS       T00015                                 

Gene name
ald
Definition
(RefSeq) L-alanine dehydrogenase
  KO
K00259  alanine dehydrogenase [EC:1.4.1.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00250  Alanine, aspartate and glutamate metabolism
mtu00430  Taurine and hypotaurine metabolism
mtu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rv2780 (ald)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Rv2780 (ald)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.1  alanine dehydrogenase
     Rv2780 (ald)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AlaDh_PNT_C AlaDh_PNT_N 2-Hacid_dh_C Shikimate_DH NAD_binding_2 GIDA Pyr_redox_2 Pyr_redox TrkA_N HI0933_like 3HCDH_N NAD_binding_7 THF_DHG_CYH_C IlvN FAD_oxidored FAD_binding_2 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 888493
NCBI-ProteinID: NP_217296
TubercuList: Rv2780
UniProt: P9WQB1 I6YEC9
Structure
PDB: 

Position
3086820..3087935
Genome map
AA seq 371 aa AA seqDB search
MRVGIPTETKNNEFRVAITPAGVAELTRRGHEVLIQAGAGEGSAITDADFKAAGAQLVGT
ADQVWADADLLLKVKEPIAAEYGRLRHGQILFTFLHLAASRACTDALLDSGTTSIAYETV
QTADGALPLLAPMSEVAGRLAAQVGAYHLMRTQGGRGVLMGGVPGVEPADVVVIGAGTAG
YNAARIANGMGATVTVLDINIDKLRQLDAEFCGRIHTRYSSAYELEGAVKRADLVIGAVL
VPGAKAPKLVSNSLVAHMKPGAVLVDIAIDQGGCFEGSRPTTYDHPTFAVHDTLFYCVAN
MPASVPKTSTYALTNATMPYVLELADHGWRAACRSNPALAKGLSTHEGALLSERVATDLG
VPFTEPASVLA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcggtattccgaccgagaccaaaaacaacgaattccgggtggccatcaccccg
gccggcgtcgcggaactaacccgtcgtggccatgaggtgctcatccaggcaggtgccgga
gagggctcggctatcaccgacgcggatttcaaggcggcaggcgcgcaactggtcggcacc
gccgaccaggtgtgggccgacgctgatttattgctcaaggtcaaagaaccgatagcggcg
gaatacggccgcctgcgacacgggcagatcttgttcacgttcttgcatttggccgcgtca
cgtgcttgcaccgatgcgttgttggattccggcaccacgtcaattgcctacgagaccgtc
cagaccgccgacggcgcactacccctgcttgccccgatgagcgaagtcgccggtcgactc
gccgcccaggttggcgcttaccacctgatgcgaacccaagggggccgcggtgtgctgatg
ggcggggtgcccggcgtcgaaccggccgacgtcgtggtgatcggcgccggcaccgccggc
tacaacgcagcccgcatcgccaacggcatgggcgcgaccgttacggttctagacatcaac
atcgacaaacttcggcaactcgacgccgagttctgcggccggatccacactcgctactca
tcggcctacgagctcgagggtgccgtcaaacgtgccgacctggtgattggggccgtcctg
gtgccaggcgccaaggcacccaaattagtctcgaattcacttgtcgcgcatatgaaacca
ggtgcggtactggtggatatagccatcgaccagggcggctgtttcgaaggctcacgaccg
accacctacgaccacccgacgttcgccgtgcacgacacgctgttttactgcgtggcgaac
atgcccgcctcggtgccgaagacgtcgacctacgcgctgaccaacgcgacgatgccgtat
gtgctcgagcttgccgaccatggctggcgggcggcgtgccggtcgaatccggcactagcc
aaaggtctttcgacgcacgaaggggcgttactgtccgaacgggtggccaccgacctgggg
gtgccgttcaccgagcccgccagcgtgctggcctga

DBGET integrated database retrieval system