KEGG   Mycobacterium tuberculosis H37Rv: Rv2786cHelp
Entry
Rv2786c           CDS       T00015                                 

Gene name
ribF
Definition
(RefSeq) bifunctional riboflavin kinase/FMN adenylyltransferase
  KO
K11753  riboflavin kinase / FMN adenylyltransferase [EC:2.7.1.26 2.7.7.2]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00740  Riboflavin metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Rv2786c (ribF)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.26  riboflavin kinase
     Rv2786c (ribF)
   2.7.7  Nucleotidyltransferases
    2.7.7.2  FAD synthetase
     Rv2786c (ribF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_syn Flavokinase CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 888468
NCBI-ProteinID: NP_217302
TubercuList: Rv2786c
UniProt: I6X5C9
Position
complement(3093905..3094900)
Genome map
AA seq 331 aa AA seqDB search
MRRRLAIVQRWRGQDEIPTDWGRCVLTIGVFDGVHRGHAELIAHAVKAGRARGVPAVLMT
FDPHPMEVVYPGSHPAQLTTLTRRAELVQDLGIEVFLVMPFTTDFMKLTPDRFIHELLVE
HLHVVEVVVGENFTFGKKAAGNVDTLRRAGERFGFAVESMSLVSEHHSNETVTFSSTYIR
SCVDAGDMVAAMEALGRPHRVEGVVVRGEGRGAELGFPTANVAPPMYSAIPADGVYAAWF
TVLGHGPVTGTVVPGERYQAAVSVGTNPTFSGRTRTVEAFVLDTTADLYGQHVALDFVGR
IRGQKKFESVRQLVAAMGADTERARDLLSTG
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccgtaggcttgcgatcgtgcagcgctggcgtggccaggacgagatcccgacggat
tggggcagatgcgtgctcaccatcggggtatttgacggcgtgcaccgcgggcacgccgaa
ctgatcgcgcacgcggtcaaggccggccgcgctcgcggtgtaccggccgtgctgatgacg
ttcgacccgcacccgatggaggtggtctatccaggcagtcacccggcgcagctgaccacc
ctgacccgacgcgcggagctcgttcaagacttgggcatcgaagtgttcctggtgatgccg
ttcaccaccgatttcatgaagctcacgccggatcgcttcatccatgagctgctcgtcgag
cacctacatgtggtggaggtcgtcgtcggcgagaacttcaccttcggcaaaaaggccgcc
ggcaatgtcgacacgctgcgtcgggctggcgagcggttcgggttcgcggtggaatcgatg
tcgttggtgtccgagcaccacagcaacgagaccgtgacgttctcctccacctacatccgg
tcctgcgtggacgccggcgacatggtggcggccatggaagctctgggccgaccgcaccgc
gtggagggggttgtggtacgcggtgaggggcggggcgcggagctgggctttcccaccgcg
aacgtggcgccgccgatgtattcggcgattccggccgacggcgtgtacgccgcttggttc
acggtgctcgggcatgggccggtgaccggcacggtcgtcccgggtgagcgctaccaggcc
gcggtgtcggtcgggaccaatcccaccttctccggacgcacccgcaccgtcgaagcgttc
gtgctggacaccaccgctgacctctacggtcaacatgtggccttggacttcgtcgggcgt
atccgcggccagaagaagttcgaatcggtgcgccagctggtcgctgcgatgggtgccgat
accgagcgggcacgtgacctgttgtctacgggttga

DBGET integrated database retrieval system