KEGG   Mycobacterium tuberculosis H37Rv: Rv2834cHelp
Entry
Rv2834c           CDS       T00015                                 

Gene name
ugpE
Definition
(RefSeq) sn-glycerol-3-phosphate ABC transporter permease UgpE
  KO
K05815  sn-glycerol 3-phosphate transport system permease protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu02010  ABC transporters
Module
mtu_M00198  Putative sn-glycerol-phosphate transport system
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Rv2834c (ugpE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mtu02000]
    Rv2834c (ugpE)
Transporters [BR:mtu02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative sn-Glycerol 3-phosphate transporter [MD:M00198] [OT]
    Rv2834c (ugpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-GeneID: 888534
NCBI-ProteinID: NP_217350
TubercuList: Rv2834c
UniProt: A0A089QVY9 I6Y1U3
Position
complement(3140487..3141314)
Genome map
AA seq 275 aa AA seqDB search
MTPDRLRSSVGYAAMLLVVTLIAGPLLFVFFTSFKDQPDIYAQPTSWWPLRWYPQNYRTA
TEQIPFWTFLRNSLIITSVLAVVKFTLGVLSAFGLVFVRFPGRTAVFLVIIAALMVPNQI
TVISNYALISHLGLRNTFAGIILPLAGVAFGTFLMRNHFLSLPAEIIEAARMDGARWWQL
LLRVVLPMSRPTMVAVGVITVVNEWNEYLWPFLMSDDESVAPLPIGLTFLQQAEGVTNWG
PVMAVTLLAMLPILLVFIALQRQMIKGLTSGAVKG
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
gtgacgccggatcggctccgtagcagcgttggctacgcggccatgttgctggtggtcacg
ctgattgccgggccgttgctgttcgtgttcttcacctcgttcaaggatcagcccgacatc
tatgcgcagcccaccagttggtggccgctgcgctggtacccgcagaactaccgcacggcc
accgagcagattccgttctggacgtttctgcgcaactcgctgatcatcacgtcggtgctg
gcggtggtgaagttcacgctcggtgtgctcagcgcctttggcttggtgtttgtccggttc
ccgggccgcacggcggtgtttttggtgatcatcgccgcgttgatggtgcccaaccagatc
accgtgatttccaactacgcgctgatctcacacctgggcctgcgcaacacctttgccggc
atcatcctgcctctggcgggggtggcgtttggaaccttcttgatgcgcaaccactttctg
tcgctgcccgccgagatcatcgaggcggcccggatggacggcgcgcggtggtggcaactg
ctgctgcgggtggtgttgccgatgtcgcggcccaccatggtcgccgtcggtgtcatcacc
gtggtcaacgaatggaacgaatacctgtggccgttcctgatgtccgacgacgaatcggtg
gcaccactgccgataggtctgacgtttctgcagcaggccgagggtgtgacgaactggggc
ccggtgatggcggtgacgctgttggcgatgctgccgatcttgctggtcttcatcgccttg
cagcggcagatgataaagggcctcacctcgggcgcggtcaagggatag

DBGET integrated database retrieval system