KEGG   Mycobacterium tuberculosis H37Rv: Rv2858cHelp
Entry
Rv2858c           CDS       T00015                                 

Gene name
aldC
Definition
(RefSeq) aldehyde dehydrogenase AldC
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00010  Glycolysis / Gluconeogenesis
mtu00053  Ascorbate and aldarate metabolism
mtu00071  Fatty acid degradation
mtu00280  Valine, leucine and isoleucine degradation
mtu00310  Lysine degradation
mtu00330  Arginine and proline metabolism
mtu00340  Histidine metabolism
mtu00380  Tryptophan metabolism
mtu00410  beta-Alanine metabolism
mtu00561  Glycerolipid metabolism
mtu00620  Pyruvate metabolism
mtu00625  Chloroalkane and chloroalkene degradation
mtu00903  Limonene and pinene degradation
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rv2858c (aldC)
   00053 Ascorbate and aldarate metabolism
    Rv2858c (aldC)
   00620 Pyruvate metabolism
    Rv2858c (aldC)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Rv2858c (aldC)
   00561 Glycerolipid metabolism
    Rv2858c (aldC)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rv2858c (aldC)
   00310 Lysine degradation
    Rv2858c (aldC)
   00330 Arginine and proline metabolism
    Rv2858c (aldC)
   00340 Histidine metabolism
    Rv2858c (aldC)
   00380 Tryptophan metabolism
    Rv2858c (aldC)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rv2858c (aldC)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Rv2858c (aldC)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Rv2858c (aldC)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Rv2858c (aldC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 888636
NCBI-ProteinID: NP_217374
TubercuList: Rv2858c
UniProt: A0A089QW09 O33340
Position
complement(3169356..3170723)
Genome map
AA seq 455 aa AA seqDB search
MSTTQLINPATEEVLASVDHTDANAVDDAVQRARAAQRRWARLAPAQRAAGLRAFAAAVQ
AHLDELAALEVANSGHPIVSAEWEAGHVRDVLAFYAASPERLSGRQIPVAGGVDVTFNEP
MGVVGVITPWNFPMVIASWAIAPALAAGNAVLVKPAELTPLTTMRLGELAVEAGLDEDLL
QVLPGKGTVVGERFVTHPDIRKIVFTGSTEVGKRVMAGAAAQVKRVTLELGGKSANIVFH
DCDLERAATTAPAGVFDNAGQDCCARSRILVQRSVYDRFMELLEPAVHSIVVGDPGSRAT
EMGPLVSRAHRDKVAGYVPDDAPVAFRGTAPAGRGFWFPPTVLTPKRGDRTVTDEIFGPV
VVVLTFDDEADAISLANDTAYGLSGSIWTDDLSRALRVARAVESGNLSVNSHSSVRFNTP
FGGFKQSGVGRELGPDAPLQFTETKNVFIAVGEEM
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccacgcaactgatcaatcccgccaccgaggaagtgctggcctcagttgaccac
accgacgccaacgcggtggacgacgccgtgcaacgcgcgcgagcagcgcagcggcgctgg
gcacggttggcaccggcgcagcgggcggccggcctgcgcgcattcgcggcagccgtgcaa
gcccacctcgacgaactggccgcgctcgaggtagccaattccggacatccgatcgtgtcg
gccgagtgggaagccggccacgtgcgtgacgtgttggcgttctatgccgccagcccggaa
cggttgtccggcaggcagattcccgttgccggcggggtggacgtcactttcaacgaaccg
atgggcgtggtcggtgtgatcacgccatggaatttcccgatggtgatcgcgtcctgggcc
atcgcgccggcgctggccgccggcaacgcggtgctggtcaaacccgccgaactgacgccg
ctgaccacgatgcggctcggtgagctggccgtcgaggcgggtctggacgaagacctgctg
caggtgttgccgggaaagggcacggtggtcggggagcggttcgtcacccaccccgacatt
cgcaagatcgtgttcaccgggtccaccgaagtcggcaagcgggtcatggccggtgccgcg
gctcaagtcaaacgagtgacgttggaactgggtggcaagagcgccaacatcgtcttccac
gactgcgacctggagcgcgccgcgacgaccgcgccggccggggtcttcgacaacgctggg
caggattgctgtgcccgaagtcgaatcctggtgcagcgcagcgtttacgaccggtttatg
gagctgctcgagccggcggtacacagcattgtcgtcggggaccccggatcacgcgccacc
gagatgggtccgctggtatcgcgcgcacaccgtgacaaggtcgccggttatgtgcccgac
gacgctccggtggcgtttcggggtacggctccggctgggcgcggattttggtttccacca
accgttctcacacccaaacgcggcgaccgcaccgtcaccgacgaaatcttcgggccggtg
gttgtagtgctgacgttcgacgacgaggccgacgctatcagcctggccaacgacaccgcg
tacgggctgtccggatcgatctggaccgatgacctgtcccgcgcgctgcgggtggcgcgg
gcggtcgaatccggcaacctgtcggtaaactcgcactcgtcggtgcgcttcaacaccccg
tttggcggtttcaagcagtccggtgtgggccgcgagctagggccggacgctccgctgcag
ttcaccgaaaccaaaaatgtgttcatcgccgtcggggaggagatgtga

DBGET integrated database retrieval system