KEGG   Mycobacterium tuberculosis H37Rv: Rv2870cHelp
Entry
Rv2870c           CDS       T00015                                 

Gene name
dxr
Definition
(RefSeq) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00900  Terpenoid backbone biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
Module
mtu_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rv2870c (dxr)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Rv2870c (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Sacchrp_dh_NADP Semialdhyde_dh CoA_binding_3
Motif
Other DBs
NCBI-GeneID: 887800
NCBI-ProteinID: NP_217386
TubercuList: Rv2870c
UniProt: P9WNS1 I6YAH0
Structure
PDB: 

Position
complement(3181770..3183011)
Genome map
AA seq 413 aa AA seqDB search
MTNSTDGRADGRLRVVVLGSTGSIGTQALQVIADNPDRFEVVGLAAGGAHLDTLLRQRAQ
TGVTNIAVADEHAAQRVGDIPYHGSDAATRLVEQTEADVVLNALVGALGLRPTLAALKTG
ARLALANKESLVAGGSLVLRAARPGQIVPVDSEHSALAQCLRGGTPDEVAKLVLTASGGP
FRGWSAADLEHVTPEQAGAHPTWSMGPMNTLNSASLVNKGLEVIETHLLFGIPYDRIDVV
VHPQSIIHSMVTFIDGSTIAQASPPDMKLPISLALGWPRRVSGAAAACDFHTASSWEFEP
LDTDVFPAVELARQAGVAGGCMTAVYNAANEEAAAAFLAGRIGFPAIVGIIADVLHAADQ
WAVEPATVDDVLDAQRWARERAQRAVSGMASVAIASTAKPGAAGRHASTLERS
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaactcgaccgacgggcgcgctgacggccggttgcgggtggtggtgctgggcagt
accggctcgatcggcacccaggcgcttcaggtcatcgccgacaatccggaccgtttcgag
gtagtcgggctggccgctggcggcgcccatctggacacgttgctgcgacaacgtgcgcag
accggggtgaccaatattgccgtcgctgacgagcacgcggcgcagcgggtcggcgacatc
ccctaccacggatccgacgccgccacccggctggtcgagcagaccgaggccgacgtcgtc
ctcaatgcgctggtcggcgcgttgggcctgcgaccgacgttggccgcgctcaagacgggt
gcccggctggcgctggccaacaaggaatcgctggtcgccggtggttcgctggtgctgcgg
gcggcgcggcccggtcagatcgtgccggtcgactccgaacactccgcgctggcccagtgc
ctgcgcggcggcactcccgacgaggtcgccaagctggtgctgacggcctcgggagggccg
tttcggggctggtccgcggccgacctcgagcatgtcacccccgagcaggctggcgcgcat
cctacgtggtcgatgggcccgatgaacacgctgaattcggcgtcgctggtcaacaaggga
cttgaggtcatcgaaacccacctgctgttcggcatcccctacgaccgcatcgatgtcgtg
gtgcacccccagtcgatcatccattcgatggtcaccttcatcgacggttcgacgatcgcc
caggccagtcccccggacatgaagctaccgatttcgttagcgctgggctggccgcgtcgg
gtcagcggcgccgctgctgcctgtgatttccataccgcgtcgagctgggagttcgagccg
ttggacaccgacgtcttccccgcggtcgagttggcccggcaggccggcgtagccggtggc
tgcatgaccgcggtttacaatgcggcgaacgaagaagcagcagcggcgttccttgctggc
cggatcggcttcccggccatcgtcggcatcatcgccgacgtgttgcacgctgccgaccaa
tgggccgtcgaacccgctaccgtggatgacgtactcgacgcgcagcgctgggcccgcgag
cgagcgcagcgcgcggtatctggtatggcttcggtggcgatcgcaagcacggcgaagccg
ggcgcagcgggtcgacacgcatcgacgttagaaaggtcctga

DBGET integrated database retrieval system