KEGG   Mycobacterium tuberculosis H37Rv: Rv2881cHelp
Entry
Rv2881c           CDS       T00015                                 

Gene name
cdsA
Definition
(RefSeq) phosphatidate cytidylyltransferase
  KO
K00981  phosphatidate cytidylyltransferase [EC:2.7.7.41]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00564  Glycerophospholipid metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
Module
mtu_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Rv2881c (cdsA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.41  phosphatidate cytidylyltransferase
     Rv2881c (cdsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_1
Motif
Other DBs
NCBI-GeneID: 888910
NCBI-ProteinID: NP_217397
TubercuList: Rv2881c
UniProt: P9WPF7 I6YAI0
Position
complement(3190701..3191621)
Genome map
AA seq 306 aa AA seqDB search
MTTNDAGTGNPAEQPARGAKQQPATETSRAGRDLRAAIVVGLSIGLVLIAVLVFVPRVWV
AIVAVATLVATHEVVRRLREAGYLIPVIPLLIGGQAAVWLTWPFGAVGALAGFGGMVVVC
MIWRLFMQDSVTRPTTGGAPSPGNYLSDVSATVFLAVWVPLFCSFGAMLVYPENGSGWVF
CMMIAVIASDVGGYAVGVLFGKHPMVPTISPKKSWEGFAGSLVCGITATIITATFLVGKT
PWIGALLGVLFVLTTALGDLVESQVKRDLGIKDMGRLLPGHGGLMDRLDGILPSAVAAWI
VLTLLP
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaccaacgatgccggcaccggaaaccccgccgagcagccggcgcgtggtgctaaa
cagcagccggcgaccgaaacgtcccgcgccggccgtgatttgcgcgcagcgatcgtggtg
ggcctttccataggcctagtcctcatcgcggtgctggtgttcgttccgcgcgtttgggtt
gccatcgtggccgtcgccaccttggtcgctacccatgaggtggtgcggaggttgcgggaa
gcgggctatctcatcccggttatcccgttgctgattggcgggcaggccgcggtgtggctg
acctggccgttcggcgcggtcggcgcattggcgggctttggtggcatggtcgttgtctgc
atgatttggcgactgttcatgcaggacagcgtgacgcgcccgacgaccggcggtgcaccg
tcgccgggaaactacttgtccgacgtctcggccacggtcttcctggccgtgtgggtccca
ttgttctgctctttcggcgcaatgctggtctacccggaaaatggctcgggatgggtgttc
tgcatgatgatcgcggtcatcgcttccgatgtcggcggctacgccgtgggggtgctgttt
ggcaagcatccgatggttccgacgatcagcccgaagaagtcgtgggagggctttgccggt
tcgctggtgtgcgggatcaccgcaacgatcatcaccgcgactttcctggtcggcaaaacg
ccgtggattggtgcactgctcggcgtgcttttcgtgctcaccaccgcgctgggcgacctg
gtggagtcgcaggtcaaacgtgacctcggcatcaaagacatgggccgcctgctacccggc
cacggcggtctgatggaccggctcgacggcatactgccttccgcggtggcggcctggata
gtcctcacactgctgccctga

DBGET integrated database retrieval system