KEGG   Mycobacterium tuberculosis H37Rv: Rv2941Help
Entry
Rv2941            CDS       T00015                                 

Gene name
fadD28
Definition
(RefSeq) long-chain-fatty-acid--AMP ligase FadD28
  KO
K12427  long-chain fatty acid adenylyltransferase FadD28 [EC:6.2.1.49]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mtu01004]
    Rv2941 (fadD28)
Enzymes [BR:mtu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.49  long-chain fatty acid adenylyltransferase FadD28
     Rv2941 (fadD28)
Lipid biosynthesis proteins [BR:mtu01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   Rv2941 (fadD28)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Mur_ligase_C
Motif
Other DBs
NCBI-GeneID: 887454
NCBI-ProteinID: NP_217457
TubercuList: Rv2941
UniProt: P9WQ59 I6XFQ7
Structure
PDB: 

Position
3283335..3285077
Genome map
AA seq 580 aa AA seqDB search
MSVRSLPAALRACARLQPHDPAFTFMDYEQDWDGVAITLTWSQLYRRTLNVAQELSRCGS
TGDRVVISAPQGLEYVVAFLGALQAGRIAVPLSVPQGGVTDERSDSVLSDSSPVAILTTS
SAVDDVVQHVARRPGESPPSIIEVDLLDLDAPNGYTFKEDEYPSTAYLQYTSGSTRTPAG
VVMSHQNVRVNFEQLMSGYFADTDGIPPPNSALVSWLPFYHDMGLVIGICAPILGGYPAV
LTSPVSFLQRPARWMHLMASDFHAFSAAPNFAFELAARRTTDDDMAGRDLGNILTILSGS
ERVQAATIKRFADRFARFNLQERVIRPSYGLAEATVYVATSKPGQPPETVDFDTESLSAG
HAKPCAGGGATSLISYMLPRSPIVRIVDSDTCIECPDGTVGEIWVHGDNVANGYWQKPDE
SERTFGGKIVTPSPGTPEGPWLRTGDSGFVTDGKMFIIGRIKDLLIVYGRNHSPDDIEAT
IQEITRGRCAAISVPGDRSTEKLVAIIELKKRGDSDQDAMARLGAIKREVTSALSSSHGL
SVADLVLVAPGSIPITTSGKVRRGACVEQYRQDQFARLDA
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgcgttcccttcccgctgcgttgcgcgcgtgtgcgcgtctgcaaccccatgac
ccggccttcacgtttatggattacgaacaggactgggacggcgttgcgataaccctgacg
tggtcgcagctgtatcggcgaacgctgaatgtggcacaggagctgagccgttgtggttcc
acgggtgaccgcgtggtgatctctgctccgcagggactcgagtacgtcgtcgcctttctc
ggcgcgttgcaggccgggcgcatcgccgtgccgctttcggttccacaaggcggcgttacc
gatgaacgttccgattcggtactgagtgattcgtcgccggtggccattctcactacatcg
tctgccgtggacgacgtcgtgcaacatgttgcgcggcggcccggggaatccccgccatca
attatcgaagttgatttgctcgatctggacgctccgaatgggtataccttcaaagaagac
gagtatccatctaccgcgtatttgcaatacacctccgggtccacccgcacgcccgctggc
gtggtgatgtcccatcagaacgttcgggttaatttcgaacagctgatgtctggctacttt
gcggataccgacgggattccaccgccaaattccgcactcgtatcctggctacccttctac
cacgacatgggtttggtaataggaatttgcgcaccaattctgggtggataccccgcggtg
ctcaccagcccggtgtcgttcctgcagcgcccggcccggtggatgcacttgatggccagc
gattttcacgccttttcggcagcaccgaatttcgcctttgaactagcggcacgaagaaca
accgacgacgacatggccgggcgtgacctcggcaacatactgaccatcctcagcggtagc
gagcgggtacaggccgcgacgatcaagcgcttcgccgaccgctttgctcgcttcaatctg
caggagagggtgatccggccttcatacgggctcgcagaagcaacggtgtacgtggcgacg
agcaaaccgggtcaaccaccggagaccgtcgacttcgatactgaaagtttatccgccggc
catgcgaagccgtgcgcaggcggcggcgctacatcgttgatcagctacatgttgccgcgg
tcaccgatcgtgcggatcgtcgactcggacacctgcatcgaatgtccggacggaaccgtc
ggcgagatctgggtgcacggcgacaacgtcgctaatggctattggcaaaaacccgacgag
agtgagcgcacgttcggcggaaagattgtcaccccttcgccgggcacacccgaaggtcct
tggctaagaacgggcgactcaggtttcgtcaccgatggcaaaatgttcatcatcggtcgg
atcaaagatctcctaattgtgtacggacgcaaccactcccccgacgacatcgaggcaacg
atccaggagatcacccgcgggcgctgcgcggcgatctcggttcccggtgaccgcagcacc
gaaaagctggtcgccattatcgaactcaagaagcgtggcgactcagatcaggacgcgatg
gctagactgggcgctattaaacgcgaagtcacgtcggctttatcgagttcgcacggtctc
agcgtcgcggatctggttctggttgcgcctggctcgatccccattaccaccagcgggaag
gtcaggagaggggcgtgtgtcgagcaatatcgacaggatcaattcgcccgcttggatgcc
tag

DBGET integrated database retrieval system