KEGG   Mycobacterium tuberculosis H37Rv: Rv2949cHelp
Entry
Rv2949c           CDS       T00015                                 

Definition
(RefSeq) chorismate pyruvate-lyase
  KO
K03181  chorismate--pyruvate lyase [EC:4.1.3.40]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00130  Ubiquinone and other terpenoid-quinone biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Rv2949c
Enzymes [BR:mtu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.40  chorismate lyase
     Rv2949c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF98 Plk4_PB1
Motif
Other DBs
NCBI-GeneID: 887206
NCBI-ProteinID: NP_217465
TubercuList: Rv2949c
UniProt: P9WIC5 I6X5T9
Position
complement(3299971..3300570)
Genome map
AA seq 199 aa AA seqDB search
MTECFLSDQEIRKLNRDLRILIAANGTLTRVLNIVADDEVIVQIVKQRIHDVSPKLSEFE
QLGQVGVGRVLQRYIILKGRNSEHLFVAAESLIAIDRLPAAIITRLTQTNDPLGEVMAAS
HIETFKEEAKVWVGDLPGWLALHGYQNSRKRAVARRYRVISGGQPIMVVTEHFLRSVFRD
APHEEPDRWQFSNAITLAR
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagtgttttctatctgatcaagagatccgaaagctcaatcgtgaccttcgaata
ctgatagcagctaatggcaccctcactagggttctcaacattgtcgctgacgatgaggtg
atcgtgcaaatcgtcaagcagcggattcacgatgtttcaccgaagctatccgaattcgag
cagctagggcaggtgggggtcggccgtgttctgcagcggtacatcatacttaaaggtcgg
aactcggaacacttatttgtagccgcggagtcgttgattgcgattgatcggttgccggct
gcaattataacaaggttgacgcagacaaacgatcctctcggcgaggttatggcagccagc
cacatcgagaccttcaaggaagaggctaaagtctgggtcggagatttgccaggttggctc
gcgctccacgggtatcagaattcccgaaagagagccgttgcccgccgttatcgcgttatt
tccggaggccagccgatcatggtggtgacggagcactttctacgaagcgtatttcgagat
gctccgcatgaagaacctgatcgctggcagttttcaaatgccatcactctggcgcgctag

DBGET integrated database retrieval system