KEGG   Mycobacterium tuberculosis H37Rv: Rv2951cHelp
Entry
Rv2951c           CDS       T00015                                 

Definition
(RefSeq) phthiodiolone/phenolphthiodiolone dimycocerosates ketoreductase
  KO
K14728  phthiodiolone/phenolphthiodiolone dimycocerosates ketoreductase [EC:1.2.-.-]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Rv2951c
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.-  Acting on the aldehyde or oxo group of donors
    1.2.-.-  
     Rv2951c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_luciferase
Motif
Other DBs
NCBI-GeneID: 887887
NCBI-ProteinID: NP_217467
TubercuList: Rv2951c
UniProt: P9WIB7 I6Y239
Position
complement(3303103..3304248)
Genome map
AA seq 381 aa AA seqDB search
MGGLRFGFVDALVHSRLPPTLPARSSMAAATVMGADSYWVGDHLNALVPRSIATSEYLGI
AAKFVPKIDANYEPWTMLGNLAFGLPSRLRLGVCVTDAGRRNPAVTAQAAATLHLLTRGR
AILGIGVGEREGNEPYGVEWTKPVARFEEALATIRALWNSNGELISRESPYFPLHNALFD
LPPYRGKWPEIWVAAHGPRMLRATGRYADAWIPIVVVRPSDYSRALEAVRSAASDAGRDP
MSITPAAVRGIITGRNRDDVEEALESVVVKMTALGVPGEAWARHGVEHPMGADFSGVQDI
IPQTMDKQTVLSYAAKVPAALMKEVVFSGTPDEVIDQVAEWRDHGLRYVVLINGSLVNPS
LRKTVTAVLPHAKVLRGLKKL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgggcggacttcgtttcggttttgttgatgccctcgtgcactcgcggttgccgccgacc
ctgccggcacggtctagcatggcggccgccaccgtgatgggcgccgactcgtattgggtc
ggcgaccatctgaatgcgctggtgccgcgctcgattgcgacttccgaatatctcggaatt
gcggcgaaattcgtgcccaagatcgatgccaattacgaaccgtggacgatgcttggaaac
ctcgccttcgggttgcccagccgtctgcgactgggcgtgtgcgtgaccgatgcaggtcgg
cgcaatccagcggtcacagcccaggctgccgcgactttgcacttgcttacccgaggccga
gccatattgggtatcggtgtcggggaacgtgaaggcaacgagccctacggtgtggagtgg
accaaaccggtggcgcggttcgaagaagccctggccaccattcgcgcgttgtggaattca
aacggggagcttatctcacgtgaatcgccatactttccgttacataacgccttgttcgac
cttccgccataccgtgggaaatggcccgaaatctgggtcgcggcccacgggccgcggatg
ttacgggccaccggacgttacgccgatgcctggattcccattgttgtggttcgtcccagc
gactacagtcgcgcactcgaagcggtgcgcagcgcggcgtccgatgccggacgcgaccca
atgtcgattactccggcggcggtgcgcggcatcatcactggacggaatcgcgacgacgtg
gaagaggcgctggaatctgtcgttgtgaagatgaccgcgctcggggtacctggggaagcc
tgggcgcgtcacggcgtcgagcatccaatgggagccgacttctccggtgtgcaggacatc
atcccgcaaaccatggacaaacagacggttttgtcctacgcggccaaggtcccggctgcg
cttatgaaagaagtcgtcttcagtggaacccctgacgaagtcatcgatcaagtagcggaa
tggcgagatcacgggctgcgctacgttgtgctgatcaacggcagtttggttaaccccagc
ctgcgcaagacggtgacggctgtcctgccgcacgccaaggttttgcgcgggctcaagaag
ctatga

DBGET integrated database retrieval system