KEGG   Mycobacterium tuberculosis H37Rv: Rv2952Help
Entry
Rv2952            CDS       T00015                                 

Definition
(RefSeq) phthiotriol/phenolphthiotriol dimycocerosates methyltransferase
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 Methyltransf_12 Ubie_methyltran Methyltransf_23 Methyltransf_29 MetW Methyltransf_8 MTS Pox_MCEL DUF938
Motif
Other DBs
NCBI-GeneID: 887311
NCBI-ProteinID: NP_217468
TubercuList: Rv2952
UniProt: P9WIN3 I6XFR4
Position
3304441..3305253
Genome map
AA seq 270 aa AA seqDB search
MAFSRTHSLLARAGSTSTYKRVWRYWYPLMTRGLGNDEIVFINWAYEEDPPMDLPLEASD
EPNRAHINLYHRTATQVDLGGKQVLEVSCGHGGGASYLTRTLHPASYTGLDLNQAGIKLC
KKRHRLPGLDFVRGDAENLPFDDESFDVVLNVEASHCYPHFRRFLAEVVRVLRPGGYFPY
ADLRPNNEIAAWEADLAATPLRQLSQRQINAEVLRGIGNNSQKSRDLVDRHLPAFLRFAG
REFIGVQGTQLSRYLEGGELSYRMYCFTKD
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggccttcagtcgaacccacagcctcctcgcccgcgcgggcagtacctcgacctacaag
agagtttggcggtactggtacccgttgatgacgcgcggactcggtaacgacgaaatcgtg
ttcatcaactgggcctatgaggaagatccgccgatggacctgccactggaggcatccgac
gagcccaaccgagcccacatcaacctgtaccaccgcaccgcgacccaggtcgatctgggc
ggcaagcaggtgctggaggtcagttgcggacacggcggcggagcctcttacctcacacgc
acgttgcacccggcctcctacaccggcctggacttgaaccaggcgggaatcaagttgtgc
aagaaacgacaccggctgcctggtttggacttcgtgcgaggtgacgccgaaaacctgccc
ttcgacgacgaatccttcgatgttgtgctcaatgtcgaagcctcgcactgttacccgcac
tttcggcgtttcctcgccgaggtggttcgcgtgctgcgcccaggagggtacttcccatac
gccgacctgcgccccaacaatgagatcgccgcatgggaggccgacctcgctgctaccccg
ctgcggcaactgtcgcagcggcaaatcaacgccgaagtgctgcgcggcatcggaaacaat
tcacagaagtcacgggacctggtcgaccgccatttgccggccttcctgcgtttcgcgggc
cgcgaattcatcggtgtgcagggcacgcagctgtcccgctacctggaaggcggggaactc
tcgtaccggatgtactgcttcaccaaggactga

DBGET integrated database retrieval system