KEGG   Mycobacterium tuberculosis H37Rv: Rv2959cHelp
Entry
Rv2959c           CDS       T00015                                 

Definition
(RefSeq) rhamnosyl O-methyltransferase
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CmcI Methyltransf_24 SIR2_2
Motif
Other DBs
NCBI-GeneID: 887862
NCBI-ProteinID: NP_217475
TubercuList: Rv2959c
UniProt: P9WIM5
Position
complement(3312101..3312838)
Genome map
AA seq 245 aa AA seqDB search
MGLVWRSRTSLVGQLIGLVRLVASFAAQLFYRPSDAVAEEYHKWYYGNLVWTKTTYMGIN
CWKSVSDMWNYQEILSELQPSLVIEFGTRYGGSAVYFANIMRQIGQPFKVLTVDNSHKAL
DPRARREPDVLFVESSSTDPAIAEQIQRLKNEYPGKIFAILDSDHSMNHVLAEMKLLRPL
LSAGDYLVVEDSNINGHPVLPGFGPGPYEAIEAYEDEFPNDYKHDAERENKFGWTSAPNG
FLIRN
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggggctagtgtggcgcagtcggactagtcttgtagggcaactgatcggactagtcagg
ttagtggcgagttttgcggcccagttattctaccggccgagcgacgcagtggcggaagaa
taccacaagtggtactacggcaacttagtgtggacgaagaccacttatatggggatcaat
tgctggaaatccgtcagcgatatgtggaattaccaggagatcctgagcgagttgcaacca
tccctcgtcatcgagttcggcacccgctacggcggctcggcggtgtattttgccaacatc
atgaggcagatcggccagccattcaaggtacttaccgtggacaactcacacaaagccctc
gatccaagagcccggcgcgaaccagatgttttgttcgttgaatcgtcatccaccgacccg
gcgattgccgaacaaattcaacgcctcaaaaacgaataccctggcaagatcttcgccatc
ttagatagcgaccactcgatgaatcatgtgctggccgagatgaaattactacggccgcta
ctctccgccggtgactacctagtagtcgaggattccaacatcaacggccacccagtcctg
cccgggtttgggcctggaccctatgaagcgatcgaggcatatgaggatgaatttccaaac
gattacaagcatgatgcggagcgggagaacaaattcggctggacttccgcgcccaacgga
tttctgatccgcaactag

DBGET integrated database retrieval system