KEGG   Mycobacterium tuberculosis H37Rv: Rv2981cHelp
Entry
Rv2981c           CDS       T00015                                 

Gene name
ddlA
Definition
(RefSeq) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00473  D-Alanine metabolism
mtu00550  Peptidoglycan biosynthesis
mtu01100  Metabolic pathways
mtu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Rv2981c (ddlA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Rv2981c (ddlA)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Rv2981c (ddlA)
Enzymes [BR:mtu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Rv2981c (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:mtu01011]
 Precursor biosynthesis
  Amino acid ligase
   Rv2981c (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 ATP-grasp_4 CPSase_L_D2 RimK ATPgrasp_ST
Motif
Other DBs
NCBI-GeneID: 888415
NCBI-ProteinID: NP_217497
TubercuList: Rv2981c
UniProt: P9WP31 I6X5X6
Structure
PDB: 

Position
complement(3336796..3337917)
Genome map
AA seq 373 aa AA seqDB search
MSANDRRDRRVRVAVVFGGRSNEHAISCVSAGSILRNLDSRRFDVIAVGITPAGSWVLTD
ANPDALTITNRELPQVKSGSGTELALPADPRRGGQLVSLPPGAGEVLESVDVVFPVLHGP
YGEDGTIQGLLELAGVPYVGAGVLASAVGMDKEFTKKLLAADGLPVGAYAVLRPPRSTLH
RQECERLGLPVFVKPARGGSSIGVSRVSSWDQLPAAVARARRHDPKVIVEAAISGRELEC
GVLEMPDGTLEASTLGEIRVAGVRGREDSFYDFATKYLDDAAELDVPAKVDDQVAEAIRQ
LAIRAFAAIDCRGLARVDFFLTDDGPVINEINTMPGFTTISMYPRMWAASGVDYPTLLAT
MIETTLARGVGLH
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgctaacgaccggcgtgatcggcgtgtccgcgttgccgtcgtgttcggcgggcgc
agcaacgagcacgccatctcgtgtgtgtccgccggcagcatcctgcgcaacctggactcg
cggcggttcgacgtgatcgcggtgggtatcaccccggcaggttcgtgggtgctcaccgac
gccaaccccgacgccctgacgatcaccaaccgggagcttcctcaggtcaaatcaggatcg
ggcaccgagctggcgctgccggccgatccgcggcgtggtggccagttggtgtcgctgccg
cccggggccggcgaggttctggagtcggtcgacgtggtgttcccggtactgcacggcccg
tacggcgaggacggcacgatccagggactgctcgaactcgccggggtgccctacgtgggc
gccggtgtgctggccagtgccgtcggcatggacaaggagttcaccaagaagctgctcgcc
gccgatggacttccggtgggtgcgtacgcggtgctgcgtccgccgcggtcgacactgcac
cgccaggagtgcgaacggctgggcttaccggtgttcgtcaaacccgcccgaggcggctcg
tcgatcggtgttagccgggtgtcgagttgggatcaactgcccgccgcggtcgcgcgggcc
cgccggcatgaccctaaggtcatcgtcgaggccgcgatcagcggccgcgagctggaatgc
ggtgtgctcgaaatgccggacggcacactggaagccagcacgctgggggagatccgggtg
gccggggtgcggggacgcgaggactctttctacgacttcgcaaccaagtatctcgacgac
gcagccgaattggacgtgcccgccaaggtcgatgaccaggtcgcagaggcgattcgtcag
ctggcgatccgggcgttcgcggctatcgactgccggggtctggccagggtggacttcttc
ctcaccgacgacggtccggtgatcaacgagatcaacacgatgccgggattcaccacgatc
tcgatgtacccgcggatgtgggcggccagcggtgtcgactatccgaccctgctggcgacg
atgatcgagacgacattggcccgcggcgtgggcctgcactag

DBGET integrated database retrieval system