KEGG   Mycobacterium tuberculosis H37Rv: Rv2984Help
Entry
Rv2984            CDS       T00015                                 

Gene name
ppk1
Definition
(RefSeq) polyphosphate kinase
  KO
K00937  polyphosphate kinase [EC:2.7.4.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00190  Oxidative phosphorylation
mtu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Rv2984 (ppk1)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Rv2984 (ppk1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mtu03019]
    Rv2984 (ppk1)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.1  polyphosphate kinase
     Rv2984 (ppk1)
Messenger RNA biogenesis [BR:mtu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     Rv2984 (ppk1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP_kinase_C_1 PP_kinase PP_kinase_C PP_kinase_N PLDc_2
Motif
Other DBs
NCBI-GeneID: 887482
NCBI-ProteinID: NP_217500
TubercuList: Rv2984
UniProt: P9WHV9 A5YKM2 A0A089QWD7
Position
3339854..3342082
Genome map
AA seq 742 aa AA seqDB search
MMSNDRKVTEIENSPVTEVRPEEHAWYPDDSALAAPPAATPAAISDQLPSDRYLNRELSW
LDFNARVLALAADKSMPLLERAKFLAIFASNLDEFYMVRVAGLKRRDEMGLSVRSADGLT
PREQLGRIGEQTQQLASRHARVFLDSVLPALGEEGIYIVTWADLDQAERDRLSTYFNEQV
FPVLTPLAVDPAHPFPFVSGLSLNLAVTVRQPEDGTQHFARVKVPDNVDRFVELAAREAS
EEAAGTEGRTALRFLPMEELIAAFLPVLFPGMEIVEHHAFRITRNADFEVEEDRDEDLLQ
ALERELARRRFGSPVRLEIADDMTESMLELLLRELDVHPGDVIEVPGLLDLSSLWQIYAV
DRPTLKDRTFVPATHPAFAERETPKSIFATLREGDVLVHHPYDSFSTSVQRFIEQAAADP
NVLAIKQTLYRTSGDSPIVRALIDAAEAGKQVVALVEIKARFDEQANIAWARALEQAGVH
VAYGLVGLKTHCKTALVVRREGPTIRRYCHVGTGNYNSKTARLYEDVGLLTAAPDIGADL
TDLFNSLTGYSRKLSYRNLLVAPHGIRAGIIDRVEREVAAHRAEGAHNGKGRIRLKMNAL
VDEQVIDALYRASRAGVRIEVVVRGICALRPGAQGISENIIVRSILGRFLEHSRILHFRA
IDEFWIGSADMMHRNLDRRVEVMAQVKNPRLTAQLDELFESALDPCTRCWELGPDGQWTA
SPQEGHSVRDHQESLMERHRSP
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcaatgatcgcaaggtgaccgaaatcgaaaacagtcccgtcacagaggtgcgg
ccagaggagcatgcgtggtatccagacgactcggcgctggcggcaccgcccgctgccacc
cccgccgcgattagcgaccagctaccctcggatcgctacctgaaccgggagctgagttgg
ctggacttcaacgcgcgcgtgcttgccctggccgccgataagtcgatgccattgctcgag
cgcgccaagtttctggcaatcttcgcgtccaatctcgacgagttctacatggtccgggtg
gccggcctcaaacgccgcgacgagatggggttgtcggtgcgctccgccgacggtctaaca
ccgcgcgaacaactaggccggatcggcgagcagactcaacagctcgccagccggcatgcc
cgggtgttcctcgattcggtgctacccgcgctcggcgaggaaggcatctacatcgtcacc
tgggccgatttggatcaggctgagcgcgaccgattgtcgacctatttcaacgaacaggtc
ttccccgtcctgaccccgctggccgtcgatcccgcccacccgttcccgtttgtcagcggg
ttgagcttgaacctggcggtcacggtacgccaacctgaagacggcacccagcatttcgcg
agggtcaaggtgcccgacaacgtcgaccgcttcgtcgaactcgctgcacgtgaggccagc
gaggaagctgcggggaccgaaggccggaccgcgctgcggttcctgccgatggaggagctg
atcgcggccttccttccggtgcttttcccgggtatggaaatcgtcgagcaccacgcattt
cgcatcactcgcaacgctgacttcgaggttgaagaggatcgcgacgaggacctactgcag
gcgctcgagcgagaactggcccgccgccggttcggttcaccggtgcgactcgagatcgca
gacgacatgaccgagagcatgctggagttgctgcttcgcgaactcgacgtgcatcccggt
gatgtcatcgaagtgcccgggctgctcgacctatcgtcgttgtggcagatctacgccgtg
gaccgcccgacgcttaaggatcggacattcgtcccagctacccatcccgccttcgccgag
cgggaaacacccaaaagcatcttcgcgacgctgcgcgaaggcgatgtgctggttcaccat
ccgtatgactcgttctccaccagcgtgcagcgattcatcgaacaggccgcggccgacccc
aacgtgctggcgatcaaacagacgctgtaccgcacctccggcgactcgccgatcgtccgg
gcgctgatcgacgccgccgaagccggaaagcaagtggtggcactggtcgagatcaaggca
cgcttcgacgaacaggccaacatcgcctgggcgcgcgcactagaacaagccggcgtgcat
gtggcgtacgggctcgtcgggctcaagacgcactgcaagaccgccttggtggtgcgccgc
gaaggtccgacaatccggcggtactgccatgtcggcaccggcaattacaacagcaagaca
gcacgactctacgaggacgtcggactgctgaccgctgcacccgatatcggcgccgacttg
accgacttgttcaattcgctcaccggctactcacgcaagttgtcctaccgcaacttgttg
gtggccccgcacggaatccgcgccggcatcattgaccgcgtcgagcgggaggtcgcggcg
caccgtgcagagggtgcccacaacggcaaaggccgcatccgactcaagatgaatgccctt
gttgatgagcaggtcatcgatgcgctgtaccgcgcgtcgcgagccggtgtgcggatcgag
gtggtggtacgcggcatctgcgcgctgcgtccaggtgcgcagggcatttcggaaaacatc
atcgtgcgctcgattctcggccgcttcctcgagcactcgcggatcctccatttccgtgcc
atcgacgagttctggatcggcagcgccgacatgatgcaccgcaacctcgaccggcgagtc
gaggttatggctcaagtcaaaaacccgaggctgaccgcgcagctggacgaattgttcgaa
tccgcactggacccgtgcacccggtgctgggagctcgggcccgacgggcagtggaccgcg
tcgccgcaagaaggccatagcgtgcgcgaccatcaggaatcgctgatggaacggcaccgc
agcccctga

DBGET integrated database retrieval system