KEGG   Mycobacterium tuberculosis H37Rv: Rv2988cHelp
Entry
Rv2988c           CDS       T00015                                 

Gene name
leuC
Definition
(RefSeq) 3-isopropylmalate dehydratase large subunit
  KO
K01703  3-isopropylmalate/(R)-2-methylmalate dehydratase large subunit [EC:4.2.1.33 4.2.1.35]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00290  Valine, leucine and isoleucine biosynthesis
mtu00660  C5-Branched dibasic acid metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01210  2-Oxocarboxylic acid metabolism
mtu01230  Biosynthesis of amino acids
Module
mtu_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    Rv2988c (leuC)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Rv2988c (leuC)
Enzymes [BR:mtu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     Rv2988c (leuC)
    4.2.1.35  (R)-2-methylmalate dehydratase
     Rv2988c (leuC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase DUF521
Motif
Other DBs
NCBI-GeneID: 887875
NCBI-ProteinID: NP_217504
TubercuList: Rv2988c
UniProt: P9WQF5 I6Y271
Position
complement(3344654..3346075)
Genome map
AA seq 473 aa AA seqDB search
MALQTGEPRTLAEKIWDDHIVVSGGGCAPDLIYIDLHLVHEVTSPQAFDGLRLAGRRVRR
PELTLATEDHNVPTVDIDQPIADPVSRTQVETLRRNCAEFGIRLHSMGDIEQGIVHVVGP
QLGLTQPGMTIVCGDSHTSTHGAFGALAMGIGTSEVEHVLATQTLPLRPFKTMAVNVDGR
LPDGVSAKDIILALIAKIGTGGGQGHVIEYRGSAIESLSMEGRMTICNMSIEAGARAGMV
APDETTYAFLRGRPHAPTGAQWDTALVYWQRLRTDVGAVFDTEVYLDAASLSPFVTWGTN
PGQGVPLAAAVPDPQLMTDDAERQAAEKALAYMDLRPGTAMRDIAVDAVFVGSCTNGRIE
DLRVVAEVLRGRKVADGVRMLIVPGSMRVRAQAEAEGLGEIFTDAGAQWRQAGCSMCLGM
NPDQLASGERCAATSNRNFEGRQGAGGRTHLVSPAVAAATAVRGTLSSPADLN
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggccttgcagaccggcgagccacgcacactggccgagaagatttgggacgaccacatt
gtggtatcaggcgggggctgtgcgcccgacttgatctacatcgatctgcatctggtgcat
gaggtcaccagcccgcaggcgttcgacggcctgcgcctggccgggcgccgggtgcggcgg
cccgagctcaccctcgccaccgaggatcacaacgtgcccaccgtcgacatcgaccagccg
atcgccgacccggtgtcacgcacccaggtggagacgttgcgccgaaactgcgccgaattc
ggaatccggctgcattcaatgggcgatatcgagcagggcatcgtgcacgtcgtcggaccg
caattgggtctcacccagccgggaatgacgatcgtctgtggcgatagccacacctcaacc
cacggcgcattcggcgcgttggcgatgggcatcggtacgtcggaggtcgagcacgtgctg
gccacccagacgctgccgctgcggccgttcaagaccatggcggtcaacgtcgatgggcgg
ctgcccgacggtgtgtcggccaaggacatcatcctggcgttgatcgccaagatcggcacc
ggcggcggccaggggcatgtcatcgaataccggggcagcgccatcgaatcgctgtccatg
gaaggccggatgacgatctgcaacatgagcatcgaagccggcgctcgtgcgggcatggtg
gctccggacgaaaccacctacgcgttcttgcgtggtcgtccgcacgcacccaccggtgcc
cagtgggacaccgcactcgtctactggcaacggcttcgcaccgacgtcggcgccgttttc
gacaccgaggtgtatctcgacgccgcgtcgttgagcccgtttgtcacctggggcaccaac
ccaggccaaggggtaccgctggcggccgcggtgccagatccgcaactgatgaccgacgac
gccgagcggcaggccgccgagaaagcattggcgtacatggaccttcgacccggaaccgcg
atgcgcgacatcgcggtcgacgccgtgttcgtcgggtcgtgtaccaacggtcgcattgaa
gatctgcgggtggtcgccgaagtgctgcgtggccgcaaggtggccgacggcgtgcggatg
ctgatcgttccgggctcaatgcgggtacgcgcgcaggccgaggccgaagggctcggtgag
atcttcaccgacgcgggcgcgcaatggcggcaggcgggatgctcgatgtgtctgggcatg
aatcccgatcagctggcgtccggggagcgctgcgccgcgacgtccaaccgcaacttcgaa
gggcggcagggcgcgggcggccgcacacatttggtgtccccagcagtggcggccgccacc
gcggttcgcggcacactgtccagcccggccgatttgaattga

DBGET integrated database retrieval system