KEGG   Mycobacterium tuberculosis H37Rv: Rv2992cHelp
Entry
Rv2992c           CDS       T00015                                 

Gene name
gltS
Definition
(RefSeq) glutamate--tRNA ligase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00860  Porphyrin and chlorophyll metabolism
mtu00970  Aminoacyl-tRNA biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
Module
mtu_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
mtu_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rv2992c (gltS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Rv2992c (gltS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mtu01007]
    Rv2992c (gltS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mtu03016]
    Rv2992c (gltS)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:mtu02048]
    Rv2992c (gltS)
Enzymes [BR:mtu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     Rv2992c (gltS)
Amino acid related enzymes [BR:mtu01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Rv2992c (gltS)
Transfer RNA biogenesis [BR:mtu03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Rv2992c (gltS)
 Prokaryotic Type
   Other AARSs
    Rv2992c (gltS)
Prokaryotic defense system [BR:mtu02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    Rv2992c (gltS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-GeneID: 887850
NCBI-ProteinID: YP_177915
TubercuList: Rv2992c
UniProt: P9WFV9
Structure
PDB: 

Position
complement(3348805..3350277)
Genome map
AA seq 490 aa AA seqDB search
MTATETVRVRFCPSPTGTPHVGLVRTALFNWAYARHTGGTFVFRIEDTDAQRDSEESYLA
LLDALRWLGLDWDEGPEVGGPYGPYRQSQRAEIYRDVLARLLAAGEAYHAFSTPEEVEAR
HVAAGRNPKLGYDNFDRHLTDAQRAAYLAEGRQPVVRLRMPDDDLAWNDLVRGPVTFAAG
SVPDFALTRASGDPLYTLVNPCDDALMKITHVLRGEDLLPSTPRQLALHQALIRIGVAER
IPKFAHLPTVLGEGTKKLSKRDPQSNLFAHRDRGFIPEGLLNYLALLGWSIADDHDLFGL
DEMVAAFDVADVNSSPARFDQKKADALNAEHIRMLDVGDFTVRLRDHLDTHGHHIALDEA
AFAAAAELVQTRIVVLGDAWELLKFFNDDQYVIDPKAAAKELGPDGAAVLDAALAALTSV
TDWTAPLIEAALKDALIEGLALKPRKAFSPIRVAATGTTVSPPLFESLELLGRDRSMQRL
RAARQLVGHA
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgccacggaaacagtccgggtccgattctgcccttcacccaccggaactccgcac
gtcggtctggtccgcaccgcgctgttcaactgggcctacgcccggcacaccggtggcacc
ttcgtgttccgcatcgaggacaccgacgcccaacgcgacagcgaggaaagctatctggcg
ctgctggacgcgctgcgctggcttggcctggattgggatgaggggcccgaggtgggtggg
ccgtacgggccgtaccggcagtcgcagcgcgccgaaatctaccgtgacgtgctcgcccga
ctgctcgccgcgggcgaggcctaccacgctttctccacacccgaggaagtggaggcccgt
catgtcgcggccgggcgcaatcccaagctgggttacgacaatttcgatcgtcacttgacc
gacgcgcagcgtgcggcgtacctggcggagggccgccagccggtggtgcggctgcggatg
cccgatgacgacctcgcttggaatgacctggtgcgcgggcccgtgacgttcgcggctggc
tccgtacccgacttcgcgttgacccgagccagcggtgatccgttatacaccttggtcaac
ccgtgcgacgacgcgctgatgaagatcacccatgtgttgcgtggcgaggacctgctgccg
tcgacgccgcgccagctggcgctacatcaggcgttgatcaggatcggggtagctgagcgg
attccgaaattcgcgcacctcccaacggtcttgggggagggcaccaagaagctctcgaag
cgcgatccgcagtcgaacctgtttgcccaccgcgaccgcgggttcatccccgaaggcctg
ctgaactacctcgcgttgctcggctggtccatagccgacgaccacgacctgttcggtctc
gacgagatggtggccgcgttcgacgttgccgacgtcaactccagcccggcccggttcgac
cagaagaaggccgacgcgctgaacgccgagcacatccggatgctcgacgtgggcgacttc
acggtcaggctgcgcgaccatctggatacccacggccatcacatcgcgttggatgaggcg
gcattcgccgccgccgccgagttggtgcagacccgcatcgtggtgctcggtgacgcgtgg
gagctgttgaagttcttcaacgacgatcagtatgtgatcgatcccaaggccgcggccaag
gagctaggcccagacggggccgcggtgctcgacgcggccctggccgcgctgacaagtgtg
acggactggacggcacccctgatcgaggcggcccttaaggacgccttgatcgaaggtttg
gcgctcaaaccccgcaaggcgttcagccccatccgggtggccgccaccggcacgaccgtc
agcccgccgttgtttgaatcgctggagctgctcggtcgtgaccgcagcatgcagcggctg
cgcgcggcgcgccagctggtcgggcacgcgtga

DBGET integrated database retrieval system