KEGG   Mycobacterium tuberculosis H37Rv: Rv2995cHelp
Entry
Rv2995c           CDS       T00015                                 

Gene name
leuB
Definition
(RefSeq) 3-isopropylmalate dehydrogenase
  KO
K00052  3-isopropylmalate dehydrogenase [EC:1.1.1.85]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00290  Valine, leucine and isoleucine biosynthesis
mtu00660  C5-Branched dibasic acid metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01210  2-Oxocarboxylic acid metabolism
mtu01230  Biosynthesis of amino acids
Module
mtu_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    Rv2995c (leuB)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Rv2995c (leuB)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     Rv2995c (leuB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 888182
NCBI-ProteinID: NP_217511
TubercuList: Rv2995c
UniProt: P9WKK9 I6YEW7
Structure
PDB: 

Position
complement(3352458..3353468)
Genome map
AA seq 336 aa AA seqDB search
MKLAIIAGDGIGPEVTAEAVKVLDAVVPGVQKTSYDLGARRFHATGEVLPDSVVAELRNH
DAILLGAIGDPSVPSGVLERGLLLRLRFELDHHINLRPARLYPGVASPLSGNPGIDFVVV
REGTEGPYTGNGGAIRVGTPNEVATEVSVNTAFGVRRVVADAFERARRRRKHLTLVHKTN
VLTFAGGLWLRTVDEVGECYPDVEVAYQHVDAATIHMITDPGRFDVIVTDNLFGDIITDL
AAAVCGGIGLAASGNIDATRANPSMFEPVHGSAPDIAGQGIADPTAAIMSVALLLSHLGE
HDAAARVDRAVEAHLATRGSERLATSDVGERIAAAL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgcgatcattgccggtgacgggatcgggcccgaggtaaccgccgaggcggtc
aaagtgctcgacgcggttgtgccgggcgtccagaaaaccagctatgacctgggtgcgcgg
cgctttcatgccaccggcgaggtgctgccggactcggtggtggccgagctgcgcaaccac
gacgcgatcctgctcggggcgatcggtgacccgtcggtgccaagcggcgtcttggagcgc
ggtctgttgctgcgactgcgcttcgagctggatcaccacatcaacctgcgtccggcccgg
ctgtatccgggggtggccagcccgctgtccggcaatcccggcatcgacttcgtggtggtg
cgcgagggcaccgagggaccctacaccggcaacggcggggcgattcgcgtcggcacgccc
aacgaggtggccaccgaagtcagcgtgaacaccgcgttcggtgtgcggcgtgtggttgcc
gacgcgttcgagcgggctcgacggcgtcgcaagcatctgacattggtgcacaaaacgaac
gtgttgaccttcgccgggggattgtggttgcggaccgtcgacgaggtcggcgaatgctac
ccggacgtcgaggtggcctaccagcacgtcgacgccgccaccatccacatgatcaccgac
ccgggtcgcttcgacgtgatcgtcaccgacaacctgttcggcgacatcatcaccgatctg
gccgcggcggtatgtggcggtatcggcttggcggccagtgggaatatcgacgcgacccgg
gccaacccgtcgatgttcgagccggtgcatggcagcgcgccggacatcgccggtcagggc
atcgccgacccgacggcggcgatcatgtcggtggcgttattgctgtcccaccttggcgaa
cacgacgcggctgcccgggtggaccgggccgtcgaggcccatttggccacgcgtggcagc
gaacggcttgccaccagcgatgtcggcgaacggattgccgccgcgctctag

DBGET integrated database retrieval system