KEGG   Mycobacterium tuberculosis H37Rv: Rv2996cHelp
Entry
Rv2996c           CDS       T00015                                 

Gene name
serA1
Definition
(RefSeq) D-3-phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00260  Glycine, serine and threonine metabolism
mtu00680  Methane metabolism
mtu01100  Metabolic pathways
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
mtu01230  Biosynthesis of amino acids
Module
mtu_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Rv2996c (serA1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rv2996c (serA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtu04147]
    Rv2996c (serA1)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     Rv2996c (serA1)
    1.1.1.399  2-oxoglutarate reductase
     Rv2996c (serA1)
Exosome [BR:mtu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rv2996c (serA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh ACT NAD_binding_2 AdoHcyase_NAD IlvN 3HCDH_N NAD_binding_7 ACT_4 GFO_IDH_MocA UDPG_MGDP_dh_C F420_oxidored
Motif
Other DBs
NCBI-GeneID: 887154
NCBI-ProteinID: YP_177916
TubercuList: Rv2996c
UniProt: P9WNX3 I6X5Z2
Structure
PDB: 

Position
complement(3353483..3355069)
Genome map
AA seq 528 aa AA seqDB search
MSLPVVLIADKLAPSTVAALGDQVEVRWVDGPDRDKLLAAVPEADALLVRSATTVDAEVL
AAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLAASRQIPAA
DASLREHTWKRSSFSGTEIFGKTVGVVGLGRIGQLVAQRIAAFGAYVVAYDPYVSPARAA
QLGIELLSLDDLLARADFISVHLPKTPETAGLIDKEALAKTKPGVIIVNAARGGLVDEAA
LADAITGGHVRAAGLDVFATEPCTDSPLFELAQVVVTPHLGASTAEAQDRAGTDVAESVR
LALAGEFVPDAVNVGGGVVNEEVAPWLDLVRKLGVLAGVLSDELPVSLSVQVRGELAAEE
VEVLRLSALRGLFSAVIEDAVTFVNAPALAAERGVTAEICKASESPNHRSVVDVRAVGAD
GSVVTVSGTLYGPQLSQKIVQINGRHFDLRAQGINLIIHYVDRPGALGKIGTLLGTAGVN
IQAAQLSEDAEGPGATILLRLDQDVPDDVRTAIAAAVDAYKLEVVDLS
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctgcctgttgtgttgatcgccgacaaacttgccccatcaacggttgccgccttg
ggagatcaggtcgaggtgcgctgggttgacggtccggaccgagacaagctgctggccgcg
gtgcccgaagcggacgcgctgctggtgcgatcggccaccacggttgacgccgaggtgctg
gccgccgcccccaagctcaagatcgtcgcgcgcgccggcgtcgggctggacaacgtcgac
gtggacgccgcgacggcccgcggcgtgctggtggtcaacgccccgacgtcgaacatccac
agcgccgcggagcatgcgctggcgctgctgctggccgcctcacgccagattccggcggcc
gacgcgtcgctgcgcgagcacacctggaagcgttcgtcgttttccggtaccgagatcttc
ggcaaaaccgtcggcgtggtgggtctgggccgcatcgggcagttggtcgcccagcggatc
gctgcgttcggcgcttacgtcgtcgcctatgacccgtacgtttcgccggcccgtgcggcg
cagctgggcatcgaactgctgtccctggacgacctgctggcccgcgccgatttcatctcg
gtgcacctaccgaaaacaccggagacggcgggactgatcgacaaggaggcgctggcgaag
accaagccgggcgtcatcatcgtcaacgccgcgcgcggcggcctggtggacgaggcggca
ctggccgacgcgatcaccggcggccacgtgcgggcggccggtctggacgtgttcgccacc
gaaccgtgcaccgacagcccgctgttcgagctggcacaggtggtggtcacaccgcatctg
ggtgcgtccaccgcggaggcgcaggaccgggcgggcaccgacgtcgccgagagcgtgcgg
ctggccctggcaggggaattcgtgcccgacgcggtcaacgtcggcggcggagtggtcaac
gaggaggtggcgccctggctggatctggtgcgtaagctcggcgtgctggcgggtgtgttg
tccgacgaactgccggtgtcgttgtcggtgcaggtgcgcggtgagctggccgccgaagag
gttgaggtgctgcgcctttcggcgctgcgcggcctgttctcggcggtgatcgaggatgcg
gtgacatttgtcaacgcaccggcattggccgccgaacgtggcgtcaccgccgagatctgt
aaggcctcggaaagccccaaccaccgcagcgtcgtcgacgttcgcgcggtcggcgcggac
ggttcggtggtgaccgtctcgggcacgctgtatggcccacagctgtcgcagaagatcgtg
cagatcaacggccgccactttgatctgcgcgcccaggggatcaacctgatcatccactac
gtcgaccggccgggagcgctgggcaagatcggcacgttgctggggacggccggggtgaat
atccaggccgcgcagctctccgaagacgccgaaggcccgggcgcgacgattctgctgcgg
ctggaccaagacgtgcccgacgacgtgcggacggcgatcgcggcggcggtggacgcctac
aagctcgaggttgtcgatctgtcgtga

DBGET integrated database retrieval system